DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP96A15

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_176086.1 Gene:CYP96A15 / 842150 AraportID:AT1G57750 Length:497 Species:Arabidopsis thaliana


Alignment Length:509 Identity:118/509 - (23%)
Similarity:210/509 - (41%) Gaps:117/509 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KANGQNYI--WNFL-FAPE--YNIVRAED-AEEIFQSTKIT------------------------ 114
            |..||..:  |.|| ..|.  :.|.|..| ..|:.::|.:|                        
plant    26 KPQGQPILKNWPFLRMLPGMLHQIPRIYDWTVEVLEATNLTFYFKGPWLSGTDMLFTADPRNIHH 90

  Fly   115 ---------TKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFI 170
                     .|...::.|...||:|:|....:.|...||:....||   .|.|:.:....:|..:
plant    91 ILSSNFGNYPKGPEFKKIFDVLGEGILTVDFELWEEMRKSNHALFH---NQDFIELSVSSNKSKL 152

  Fly   171 K-----ILD----KNVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQ 226
            |     .||    ||:  .:||..:..:|..:.  .:.|....|.||      .:|...|:.|.:
plant   153 KEGLVPFLDNAAQKNI--IIELQDVFQRFMFDT--SSILMTGYDPMS------LSIEMLEVEFGE 207

  Fly   227 -----------RMCNPLMFF---NWYFFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQ 277
                       |...|::.:   ||  ...|..:|....|.|::...:.||..:|::  :....:
plant   208 AADIGEEAIYYRHFKPVILWRLQNW--IGIGLERKMRTALATVNRMFAKIISSRRKE--EISRAK 268

  Fly   278 VDEFGKK--QRYAMLDT----LLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALH 336
            .:.:.|.  ..|..:||    ||....:     :.|.|.:.:.:..|.||||:.|.:...||:.|
plant   269 TEPYSKDALTYYMNVDTSKYKLLKPNKD-----KFIRDVIFSLVLAGRDTTSSVLTWFFWLLSKH 328

  Fly   337 ADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVM-NGLVL 400
            ..|..:...|:....::.|      ..:|::|...:.||:||:|..|...::..:..|: :|..:
plant   329 PQVMAKLRHEINTKFDNED------LEKLVYLHAALSESMRLYPPLPFNHKSPAKPDVLPSGHKV 387

  Fly   401 PKNAQISIHIYDIMR-------DARHFPKPNQFLPERFLPENSVNRH--PFAFVPFSAGPRNCIG 456
            ..|::|.|.||.:.|       ||.      .|.|||::.:|...||  .:.|:.|::|||.|:|
plant   388 DANSKIVICIYALGRMRSVWGEDAL------DFKPERWISDNGGLRHEPSYKFMAFNSGPRTCLG 446

  Fly   457 QKFGVLEIKVLLAAVIRN--FKLLPATQLEDLTFENGIVLRTQQNIKVKFEARV 508
            :...:|::|::...:|||  ||::...::|.:.   .|:||.:..:||....::
plant   447 KNLALLQMKMVALEIIRNYDFKVIEGHKVEPIP---SILLRMKHGLKVTVTKKI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 118/503 (23%)
CYP96A15NP_176086.1 PLN02169 1..497 CDD:177826 118/507 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.