DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP94D1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_174713.1 Gene:CYP94D1 / 840356 AraportID:AT1G34540 Length:498 Species:Arabidopsis thaliana


Alignment Length:500 Identity:116/500 - (23%)
Similarity:220/500 - (44%) Gaps:94/500 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VRTADGSPLESKVFVVPGKTRFGNNLDLLNLTPANIFSYIR---ESTAKANGQNYIWNFLFAPEY 96
            |.|....|.::.:|..|||.:.     ::...|:|:...::   ||..|  ||.:.         
plant    55 VETLSRCPTQTAIFRRPGKQQL-----IMTANPSNVEYMLKTKFESFPK--GQQFT--------- 103

  Fly    97 NIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFL-- 159
                                    .::..|||.|:..|....|..:|||.:..|....|:.|:  
plant   104 ------------------------SVLEDFLGHGIFNSDGDMWWKQRKTASYEFSTKSLRDFVMS 144

  Fly   160 SIFKEESKKFIKILDK--NVGFELELNQIIPQFTLNNICETALGVKL----DDMSEGNEYRKAIH 218
            ::..|.:.:.:.:|.:  ..|..::|..|:.:|..:|||:.|..|..    .|.:.|..:.:|..
plant   145 NVTVEINTRLVPVLVEAATTGKLIDLQDILERFAFDNICKLAFNVDCACLGHDGAVGVNFMRAFE 209

  Fly   219 DFEIVFNQRMCNPLMFFNWYFFLFGDYKKYS----RILR----TIHGFSSGIIQRKRQQFKQKQL 275
            ....:.:||. ..:....|..     .||.:    |:||    |:|.|:..|::.:..|.:... 
plant   210 TAATIISQRF-RSVASCAWRI-----KKKLNIGSERVLRESIATVHKFADEIVRNRIDQGRSSD- 267

  Fly   276 GQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQ 340
                     .:..:|...::.|...  ..:.:.|.|.:|:..|.||||::|.:...||::|.:|:
plant   268 ---------HKEDLLSRFISKEEMN--SPEILRDIVISFILAGRDTTSSALSWFFWLLSMHPEVE 321

  Fly   341 ERCYEELQDL----PEDIDEVSMFQFNELI-HLECVIKESLRLFPSAPIIGRTCIEESVM-NGLV 399
            ::..:||..:    .:.|.||..|:..::: :|...|.|||||:|..|:..::|.|::|: :|..
plant   322 DKILQELNSIRARTGKRIGEVYGFEHLKMMNYLHAAITESLRLYPPVPVDIKSCAEDNVLPDGTF 386

  Fly   400 LPKNAQISIHIYDIMRDARHFPKP-NQFLPERFLPENS---VNRHPFAFVPFSAGPRNCIGQKFG 460
            :.|...|:.:|:.:.|....:.|. ::|.|||::.|.:   ....|..|..|.||||.|:|:...
plant   387 VGKGWAITYNIFAMGRMESIWGKDCDRFDPERWIDETNGCFRGEDPSKFPAFHAGPRMCVGKDMA 451

  Fly   461 VLEIKVLLAAVIRNFKL-LPATQLED------LTFENGIVLRTQQ 498
            .:::|.::|||:..|.: :|..:..:      |..:.|:..|.|:
plant   452 YIQMKSIVAAVLERFVVEVPGKERPEILLSMTLRIKGGLFARVQE 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 112/483 (23%)
CYP94D1NP_174713.1 CYP86A 64..490 CDD:410687 110/483 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.