DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP87A2

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001184974.1 Gene:CYP87A2 / 837830 AraportID:AT1G12740 Length:478 Species:Arabidopsis thaliana


Alignment Length:560 Identity:117/560 - (20%)
Similarity:200/560 - (35%) Gaps:161/560 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWIALLGSSLLIGALWLLLRQLNKTYFILS----LCKRVRTADGS---PL--ESKVFVVPGKT-- 54
            || |||        :|:.|..::.|:::.|    .| |.:...||   ||  ||..|..|.||  
plant     1 MW-ALL--------IWVSLLLISITHWVYSWRNPKC-RGKLPPGSMGFPLLGESIQFFKPNKTSD 55

  Fly    55 -------RFGNNLDLLNLTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTK 112
                   |..|::|:....|  ||.               .|.:..|   ::.:.||:       
plant    56 IPPFIKERVKNDVDMCRYGP--IFK---------------TNLVGRP---VIVSTDAD------- 93

  Fly   113 ITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNV 177
                 :||.:   |..:|...   |.|:.              .:|..||.:          |||
plant    94 -----LSYFV---FNQEGRCF---QSWYP--------------DTFTHIFGK----------KNV 123

  Fly   178 GFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRM-------------C 229
            |   .|:..:.:: |.|:..|..|      .:|  .:|.:...|:..|:|:             .
plant   124 G---SLHGFMYKY-LKNMVLTLFG------HDG--LKKMLPQVEMTANKRLELWSNQDSVELKDA 176

  Fly   230 NPLMFFNWYF--FLFGDYKKYSRILR-TIHGFSSGII-----------------QRKRQQFKQKQ 274
            ...|.|:...  .:..|..|.|..|| ....|..|:|                 :.|..:..:..
plant   177 TASMIFDLTAKKLISHDPDKSSENLRANFVAFIQGLISFPFDIPGTAYHKCLQGRAKAMKMLRNM 241

  Fly   275 LGQVDEFGKKQRYAMLDTLL-AAEAEGKIDHQGIC-DEVNTFMFGGYDTTSTSLIFTLLLLALHA 337
            |.:..|..:|......|.:: ..:.||.|..:.|. |.:...:|..::|||.:|...:..|:...
plant   242 LQERRENPRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLSDDP 306

  Fly   338 DVQERCYEELQDL---PEDIDE-VSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGL 398
            :|.:|..||.:.:   .||.|. ::..::..:.:....|.|:.||....|.|.|..:.:......
plant   307 EVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALRDIKFKDY 371

  Fly   399 VLPKNAQI-----SIHIYDIMRDARHFPKPNQFLPERFLPENSVN--RHPFAFVPFSAGPRNCIG 456
            .:|....:     ::|:...|     :..|..|.|.|:......|  :|   |:.|..|.|.|:|
plant   372 TIPAGWAVMVCPPAVHLNPEM-----YKDPLVFNPSRWEGSKVTNASKH---FMAFGGGMRFCVG 428

  Fly   457 QKFGVLEIKVLLAAVIRNFKLLP-----ATQLEDLTFENG 491
            ..|..|::...|.:::..::...     .|:...|.|.||
plant   429 TDFTKLQMAAFLHSLVTKYRWEEIKGGNITRTPGLQFPNG 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 99/501 (20%)
CYP87A2NP_001184974.1 p450 4..475 CDD:299894 114/556 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.