DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP735A1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_198661.1 Gene:CYP735A1 / 833833 AraportID:AT5G38450 Length:518 Species:Arabidopsis thaliana


Alignment Length:554 Identity:154/554 - (27%)
Similarity:236/554 - (42%) Gaps:124/554 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGALWLLLRQLNKTYFILSLC-KRVRTADGSPLESKVFVVPGKTRFGNNL--DLL-NLTPANIFS 72
            |...||..|::.|......:. .:.|...|:.||....|....::..:::  |:: .|.|    .
plant    25 ISCYWLTPRRIKKIMEQQGVTGPKPRPLTGNILEISAMVSQSASKDCDSIHHDIVGRLLP----H 85

  Fly    73 YIRESTAKANGQNYI-WNFLFAPEYNIVRAEDAEEIFQS----------TKITTKNMSYELIRPF 126
            |:  :.:|..|:.:| ||.. .|...:...|..:|:...          .:..|||        |
plant    86 YV--AWSKQYGKRFIVWNGT-DPRLCLTETELIKELLMKHNGVSGRSWLQQQGTKN--------F 139

  Fly   127 LGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVG---FELELNQIIP 188
            :|.|||::..|.||.:|....|||....|:.:.....|.:.|.::.|.|.||   .|:|:.:.:.
plant   140 IGRGLLMANGQDWHHQRHLAAPAFTGERLKGYARHMVECTSKLVERLRKEVGEGANEVEIGEEMH 204

  Fly   189 QFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFN-----QRMCNPL---MFFNWYFFLFGDY 245
            :.|.:.|..|..|   ....:|.|          :||     ||.|...   :.|....||...|
plant   205 KLTADIISRTKFG---SSFEKGKE----------LFNHLTVLQRRCAQATRHLCFPGSRFLPSKY 256

  Fly   246 KKYSRIL-RTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYA--MLDTLLAAEAEGKIDH--- 304
            .:..:.| :.:......|||.:|         ...|.|:...:.  :|..||   .|..||.   
plant   257 NREIKSLKKEVERLLIEIIQSRR---------DCAEMGRSSTHGDDLLGLLL---NEMDIDKNNN 309

  Fly   305 ------QGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQD------LPEDIDEV 357
                  |.|.||..||.|.|::||:..|.:|.:|||.:...||:..||:::      ||      
plant   310 NNNNNLQLIMDECKTFFFAGHETTALLLTWTTMLLADNPTWQEKVREEVREVFGRNGLP------ 368

  Fly   358 SMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPK 422
            |:.|.::|..|..||.|||||:|.|.::.|...|:..:..|.:||...|.|.:..|......:.|
plant   369 SVDQLSKLTSLSKVINESLRLYPPATLLPRMAFEDLKLGDLTIPKGLSIWIPVLAIHHSEELWGK 433

  Fly   423 -PNQFLPERFLPENSVNRHPFA----FVPFSAGPRNCIGQKFGVLEIKVLLAAVI--------RN 474
             .|||.||||      ...|||    |:||:|||||||||:|.::|.|::||.:|        :|
plant   434 DANQFNPERF------GGRPFASGRHFIPFAAGPRNCIGQQFALMEAKIILATLISKFNFTISKN 492

  Fly   475 FKLLPATQLEDLTFENGIVLRTQQNIKVKFEARV 508
            ::..|            ||:.|   ||.|:..:|
plant   493 YRHAP------------IVVLT---IKPKYGVQV 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 142/508 (28%)
CYP735A1NP_198661.1 PLN02290 1..518 CDD:215164 154/554 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.