DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP714A1

DIOPT Version :10

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_568463.1 Gene:CYP714A1 / 832560 AraportID:AT5G24910 Length:532 Species:Arabidopsis thaliana


Alignment Length:42 Identity:9/42 - (21%)
Similarity:13/42 - (30%) Gaps:15/42 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CRHIANNGVSV-PIPSRPGFFSRQH--------------PQT 37
            ||:|....:.: .:|..|......|              |||
plant   166 CRYITGYTLHLYLVPQDPSLLKELHKKEDGSGFSWVAKPPQT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 CYP4 87..502 CDD:410721
CYP714A1NP_568463.1 CYP714 91..527 CDD:410733 9/42 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.