DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CPD

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_196188.1 Gene:CPD / 830453 AraportID:AT5G05690 Length:472 Species:Arabidopsis thaliana


Alignment Length:548 Identity:135/548 - (24%)
Similarity:218/548 - (39%) Gaps:132/548 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGS---PLESKVFVVPG--KTRFGNNLDLLN 64
            ||.||:..|.|.||.|         :..:|:....||   ||..:.|.:.|  ||.        |
plant     8 LLLSSIAAGFLLLLRR---------TRYRRMGLPPGSLGLPLIGETFQLIGAYKTE--------N 55

  Fly    65 LTPANIFSYIRESTAKAN--------GQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYE 121
            ..|     :|.|..|:..        |:..|  |...||.|....::..::|:        .||.
plant    56 PEP-----FIDERVARYGSVFMTHLFGEPTI--FSADPETNRFVLQNEGKLFE--------CSYP 105

  Fly   122 L-IRPFLGDGLLISIDQKWHTRRKTLTPAF------------------HFNILQSFLS--IFKEE 165
            . |...||...|:.:....|.|..:||.:|                  .|| |.|:.|  :..||
plant   106 ASICNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIKDHLMLDIDRLVRFN-LDSWSSRVLLMEE 169

  Fly   166 SKKFIKILDKNVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCN 230
            :||        :.|||.:.|:               :..|........||   ::.:|.......
plant   170 AKK--------ITFELTVKQL---------------MSFDPGEWSESLRK---EYLLVIEGFFSL 208

  Fly   231 PLMFFNWYFFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLA 295
            ||..|:      ..|:|..:..|.:....:.::.::|::         :|.|.:::..||..|||
plant   209 PLPLFS------TTYRKAIQARRKVAEALTVVVMKRREE---------EEEGAERKKDMLAALLA 258

  Fly   296 AEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLL-------LALHADVQERCYEELQDLPED 353
            |: :|..|.: |.|.:...:..||:||||  |.||.:       ||| |.::|. :|:::.:..|
plant   259 AD-DGFSDEE-IVDFLVALLVAGYETTST--IMTLAVKFLTETPLAL-AQLKEE-HEKIRAMKSD 317

  Fly   354 IDEVSMFQFNELIHLECVIKESLRLFPSAPIIG---RTCIEESVMNGLVLPKNAQISIHIYDIMR 415
            ...:....:..:...:||:.|:||:   |.|||   |..:.:..:.|..:||..::......:..
plant   318 SYSLEWSDYKSMPFTQCVVNETLRV---ANIIGGVFRRAMTDVEIKGYKIPKGWKVFSSFRAVHL 379

  Fly   416 DARHFPKPNQFLPERFLPENSVNRHPF-AFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP 479
            |..||.....|.|.|: ..|||...|. .|.||..|||.|.|.:...:.:.|.|..::..|..:|
plant   380 DPNHFKDARTFNPWRW-QSNSVTTGPSNVFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSWVP 443

  Fly   480 ATQLEDLTFENGIVLRTQQNIKVKFEAR 507
            |.|.:.:.|.   ..|||:...:..:.|
plant   444 AEQDKLVFFP---TTRTQKRYPIFVKRR 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 119/494 (24%)
CPDNP_196188.1 p450 1..472 CDD:386267 135/548 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.