DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP96A12

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_195661.1 Gene:CYP96A12 / 830105 AraportID:AT4G39510 Length:508 Species:Arabidopsis thaliana


Alignment Length:493 Identity:113/493 - (22%)
Similarity:206/493 - (41%) Gaps:113/493 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LLNLTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIRPF 126
            |..:.|||| .||..|    |..||            .:..|.:|:|.                .
plant    79 LFTVDPANI-HYILSS----NFSNY------------TKGADFKEVFD----------------V 110

  Fly   127 LGDGLLISIDQKWHTRRKTLTPAFHFNILQSF--LSIFKEESKKFIKIL--------DKNVGFEL 181
            .|:.:..|..:.|..:||  ...|..| .|.|  ||:....||.:..::        ::.|   :
plant   111 FGEMIFSSDSELWKNQRK--AAQFMLN-HQGFQKLSLSATRSKLYDGLVPLFNQCCEEEKV---V 169

  Fly   182 ELNQIIPQFT-------LNNICETALGVKLDDMSEGNEYRKAIHDF-EIVFNQRMCNPLMFFNWY 238
            :|.|:..:||       :......:|.:::.::    ||.||:.|. |.:| .|...|..|  |.
plant   170 DLQQVFQRFTFDTTFFIVTGFDPKSLSIEMPEV----EYAKALDDLGEGIF-YRHIKPKFF--WK 227

  Fly   239 F---FLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQL-----GQVDEFGKKQRYAMLDTLLA 295
            .   |..|..|:.:....|....|:..|..||::.:.:.:     |:.::.  ...:..||| ..
plant   228 LQNRFGLGQEKRMTEADATFDRVSAKYILAKREEIRSQGIDHHANGESEDL--LTSHIKLDT-TK 289

  Fly   296 AEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDL---------P 351
            .|.....|.:.:.|.:..|...|.||||::|.:...||:.:..|..:..:|:.|.         .
plant   290 YELLNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKIRKEIIDKNISKDGRNGQ 354

  Fly   352 EDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVM-NGLVLPKNAQISIHIYDIMR 415
            |::|        :|::|...:.||:||:|......::.|:..|: :|..:..|:.|.|.::.:.|
plant   355 ENLD--------KLVYLHAALYESMRLYPPVAFQRKSPIKPDVLPSGHKVEANSVIIIFLFALGR 411

  Fly   416 -------DARHFPKPNQFLPERFLPENSVNRH--PFAFVPFSAGPRNCIGQKFGVLEIKVLLAAV 471
                   ||      .:|.|||::.|:...||  .|.|:.|:||||.|.|::..:..:|.::..:
plant   412 MRAVWGEDA------TEFKPERWVSESGGLRHAPSFKFLSFNAGPRTCPGKQLAMTLMKTVVVEI 470

  Fly   472 IRNFKL--LPATQLEDLTFENGIVLRTQQNIKVKFEAR 507
            ::|:.:  :...::|.   |.|::|..:..::|....|
plant   471 LQNYDIDVIKGQKIEP---EPGLMLHMKHGLRVTITKR 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 112/488 (23%)
CYP96A12NP_195661.1 CYP86A 66..498 CDD:410687 111/484 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.