DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP96A9

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_195658.3 Gene:CYP96A9 / 830103 AraportID:AT4G39480 Length:516 Species:Arabidopsis thaliana


Alignment Length:529 Identity:113/529 - (21%)
Similarity:212/529 - (40%) Gaps:102/529 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KVFVVPGKTR--FGNNLDLLNLTPA------NIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAE 102
            ::|::..|..  |..|..||.:.|.      .::.:|.|.....| .||::...|....:::...
plant    20 RIFLISKKPHRSFLTNWPLLGMLPGLLTVLPRVYDFITEVLEDGN-LNYLFIGPFLGGIDMLFTV 83

  Fly   103 DAEEI--FQSTKITT--KNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSF---LS 160
            |...|  ..|:....  |...::.:...||||:..:....|...||:.....:....|.|   .|
plant    84 DPANIHHIMSSNFANYPKGTEFKKLFDVLGDGIFNADSDLWKDLRKSSQSMMNHPDFQRFSLATS 148

  Fly   161 IFKEESKKFIKILDKNVGFE---LELNQIIPQFTLNNICETALG-------VKLDDMSEGNEYRK 215
            :.|.| |..:.:|| :|..|   ::|..:..:||.:.....|.|       |::.::    |:.:
plant   149 LSKLE-KGLVPLLD-HVAKEKLVVDLQDVFQRFTFDTTFVLATGYDPGCLSVEMPEI----EFAR 207

  Fly   216 AIHDFEIVFNQRMCNPLMFFNWYFFL-FGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVD 279
            |:.|.|.....|...|.:.:.....: .|...|..|.........|..|..||.:..|    .:|
plant   208 ALDDAEEAIFYRHFKPEVVWKMQRLIGVGAELKLKRAHAIFDRVCSKCIASKRDEISQ----GID 268

  Fly   280 EFGKKQ-----------RYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLL 333
            ....|.           :|.:|:         ..|.:.:.|.:.:||..|.|||.::|.:...||
plant   269 SSSSKDLLMSSINVDTTKYKLLN---------PSDDRFLRDTILSFMLAGRDTTGSALTWFFWLL 324

  Fly   334 ALHADVQERCYEELQ------------DLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIG 386
            ..:.:...:..:|:.            .:..|.|..:..:..:|::|...:.|:|||:|..|...
plant   325 CNNQEAMTKIRQEINTNLFPRNKTDDGSVSYDSDSFNPQEVKKLVYLHGAVCEALRLYPPVPFNH 389

  Fly   387 RTCIEESVM-NGLVLPKNAQISIHIYDIMR-------DARHFPKPNQFLPERFLPEN--SVNRHP 441
            ::..:..|: :|..:..|::|...:|.:.|       ||.      :|.|||::.|:  ||:...
plant   390 KSPAKPDVLPSGHKVKANSRILFCLYSLGRMKSVWGEDAM------EFKPERWISESGRSVHEPS 448

  Fly   442 FAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNF--------KLLPATQLEDLTFENGIVLRTQQ 498
            :.|:.|:||||.|:|::..:.::|.:...:|:|:        |:.||.         .::|..:.
plant   449 YKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYDINVVEGHKIKPAP---------SVILHMKH 504

  Fly   499 NIKVKFEAR 507
            .:||....|
plant   505 GLKVTVSKR 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 111/519 (21%)
CYP96A9NP_195658.3 p450 1..513 CDD:386267 112/527 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.