DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP702A6

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_680696.2 Gene:CYP702A6 / 827207 AraportID:AT4G15396 Length:475 Species:Arabidopsis thaliana


Alignment Length:425 Identity:85/425 - (20%)
Similarity:147/425 - (34%) Gaps:112/425 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 EIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTL----TPAFHFNILQSF-------- 158
            ||.::..|  ..|...|.|.|..:.|.::.|...|.|..|.    :.|....:||..        
plant    95 EIAKTNHI--PGMPKSLARLFGANNLFVNKDTHKHARSLTNQFLGSQALKLRMLQDIDFLVRTHL 157

  Fly   159 --------LSIFKEESKKFIKILDKNVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRK 215
                    |.|.:..||..|:.|.|.|..|:| .....:.||   |.|                 
plant   158 KEGARKGSLDIKETTSKIIIECLAKKVMGEME-PDAAKELTL---CWT----------------- 201

  Fly   216 AIHDFEIVFNQRMCNPLMFF--NWYFFLF-----GDY---KKYSRILRTIHGFSSGIIQRKRQQF 270
                              ||  .|:.|.:     |.|   |..:|:::.:          |....
plant   202 ------------------FFPREWFGFAWNIPGTGVYRMVKARNRMMKVL----------KETVL 238

  Fly   271 KQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLAL 335
            |::..|  :|.|...:....||....:.   |..:...:.:.|......:||...|..|:.|::.
plant   239 KKRASG--EELGDFFKTIFGDTERGVKT---ISLESATEYIFTLFLLANETTPAVLAATIKLISD 298

  Fly   336 HADVQERCYEELQDLPEDIDE------VSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESV 394
            |..|.:....|.:.:..|..|      ::...:..:...:.||.||||:..:.|.:.|....|..
plant   299 HPKVMQELQREHEGIVRDKIEKNEKADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHEFQ 363

  Fly   395 MNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPEN---SVNRHPFAFVPFSAGPRNCIG 456
            .....:|.......:.| :..:|..:..|..|.|.|:..::   .|:|   .::||.:|.|.|:|
plant   364 FGEYTIPAGWIFMGYPY-VHFNAEKYDDPLAFNPWRWKGKDLSAIVSR---TYIPFGSGSRLCVG 424

  Fly   457 QKFGVLEIKVLL-------------AAVIRNFKLL 478
            .:|..|::.:.:             ..::|.|.|:
plant   425 AEFVKLKMAIFIHHLSRYRWSMKTETTLLRRFVLI 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 85/425 (20%)
CYP702A6NP_680696.2 p450 9..454 CDD:299894 82/418 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.