DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP702A5

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001078393.1 Gene:CYP702A5 / 827206 AraportID:AT4G15393 Length:467 Species:Arabidopsis thaliana


Alignment Length:406 Identity:80/406 - (19%)
Similarity:143/406 - (35%) Gaps:99/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 EIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTL----TPAFHFNILQSF-------- 158
            ||.::..|  ..|...|.|.|....|.::.|...|.|..|.    :.|....::|..        
plant    95 EIAKTNHI--PGMPKSLERLFGATNLFVNKDTHKHARSLTNQFLGSQALKLRMIQDIDFLARTHM 157

  Fly   159 --------LSIFKEESKKFIKILDKNVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRK 215
                    |.:.:..||..|:.|.|.|..|:| .:...:.||   |.|                 
plant   158 KEGARKGCLDVKETASKIVIECLSKKVMGEME-PEAAKELTL---CWT----------------- 201

  Fly   216 AIHDFEIVFNQRMCNPLMFF--NWYFFLF-----GDY---KKYSRILRTIHGFSSGIIQRKRQQF 270
                              ||  :|:.|.:     |.|   |..:|:::.|    ...:.:||.  
plant   202 ------------------FFPRDWFRFAWNFPGTGVYRIVKARNRMMKVI----KETVVKKRA-- 242

  Fly   271 KQKQLGQVDE--FGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLL 333
            ..|:||:..|  ||..:...| ...:|.|            .:.|......:||...|..|:.|:
plant   243 SGKKLGEFFETIFGDTESVTM-SIEIATE------------YIFTLFVLANETTPGVLAATIKLI 294

  Fly   334 ALHADVQERCYEELQDLPED------IDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEE 392
            :.:..|.:....|.:.:.:|      ..:::...:..:...:.||.||||:..:.|.:.|....|
plant   295 SDNPKVMQELRREHEGIVQDKIKKDETADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHE 359

  Fly   393 SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQ 457
            .......:|.......:.| :..:...:..|..|.|.|:..::........::||.:|.|.|:|.
plant   360 IQFGDYTIPAGWIFMGYPY-VHFNPEKYDDPLAFNPWRWKGKDLSTIVSKTYLPFGSGTRLCVGA 423

  Fly   458 KFGVLEIKVLLAAVIR 473
            :|..|::.:.:..:.|
plant   424 EFVKLQMAIFIHHLFR 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 80/406 (20%)
CYP702A5NP_001078393.1 p450 30..448 CDD:386267 80/406 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.