DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and AT3G44970

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_190083.2 Gene:AT3G44970 / 823632 AraportID:AT3G44970 Length:479 Species:Arabidopsis thaliana


Alignment Length:446 Identity:98/446 - (21%)
Similarity:173/446 - (38%) Gaps:107/446 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 YELIRPFLGDGLLISIDQKWHTRRKTLT--PAFHFNIL----------QSFLSIFKEESKKFI-- 170
            || |.|:|              ::|.|.  |.|..|||          ...:.|.::|:|.||  
plant    58 YE-ISPYL--------------KKKMLRYGPLFRTNILGVKTVVSTDKDVNMEILRQENKSFILS 107

  Fly   171 ------KILDKNVGFELELNQI---IPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQ 226
                  |.|.|:..| |::..|   |.|.||:.:           .|||.: ||.:.|.:.|..:
plant   108 YPDGLMKPLGKDSLF-LKIGNIHKHIKQITLHLL-----------SSEGLK-RKILKDMDRVTRE 159

  Fly   227 RMCN----------------------PLMFFN----WYFFLFGDYKKYS-RILRTIHGFSSG--- 261
            .:.:                      |.|..|    ....|.|.:|.:: ...||.:..|:|   
plant   160 HLSSKAKTGRLDVKDAVSKLIIAHLTPKMMSNLKPQTQAKLMGIFKAFTFDWFRTSYLISAGKGL 224

  Fly   262 --IIQRKRQQFKQ-KQLGQVDEFGKKQRYAMLDTLL-AAEAEGK-IDHQGICDEVNTFMFGGYDT 321
              .:...|:..:: |.:..:.:..:::....|:|.: .:|..|: ::...|...:.|......||
plant   225 YNTLWACREGMREIKDIYTMRKTSEEKYDDFLNTAIEESEKAGELLNENAIITLIFTLSCVTQDT 289

  Fly   322 TSTSLIFTLLLLALHADVQERCYEELQDLPEDIDE----VSMFQF-NELIHLECVIKESLRLFPS 381
            ||.::...:..|..:..|.....:|.:.:.|..::    |:..:: :::.....||.||||:...
plant   290 TSKAICLAVKFLLENPKVLAELKKEHEVILESREDKEGGVTWEEYRHKMTFTNMVINESLRITNL 354

  Fly   382 APIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVP 446
            ||::.|..:::..:.|..:|....:.|....:..|...:..|.:|.|.|: ....:......|:.
plant   355 APMLFRKAVKDVEIKGYTIPAGWIVMIIPSVVHFDPEIYENPFEFNPWRW-EGKELRAGSKTFMV 418

  Fly   447 FSAGPRNCIGQKFGVLEIKVLLAAVIR--NFKL--------LPATQLEDLTFENGI 492
            |..|.|.|.|.:|..|:|.|.|..::.  ||.|        :||..|     .|||
plant   419 FGTGLRQCAGAEFARLQISVFLHHLVTTYNFSLHQDCEVLRVPAAHL-----PNGI 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 98/446 (22%)
AT3G44970NP_190083.2 p450 34..475 CDD:299894 98/446 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.