DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP72A15

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001325567.1 Gene:CYP72A15 / 820697 AraportID:AT3G14690 Length:547 Species:Arabidopsis thaliana


Alignment Length:487 Identity:116/487 - (23%)
Similarity:197/487 - (40%) Gaps:86/487 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTPANIFSYIRESTAKAN 82
            |:..|.|.:.:||      .|...||:....:.|....:          |..:|        |..
plant    87 LVGDLKKNFTMLS------EARSKPLKLTDDISPRVVPY----------PLQMF--------KTY 127

  Fly    83 GQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIRP-------FLGDGLLISIDQKWH 140
            |:.|...|...|...|:..|..:|:|        |..|:..:|       .:..||......||.
plant   128 GRTYFTWFGPIPTITIMDPEQIKEVF--------NKVYDFQKPHTFPLATIIAKGLANYDGDKWA 184

  Fly   141 TRRKTLTPAFHFNILQSFLSIFKEESKKFI-----KILDKNVGFELELNQIIPQFTLNNICETAL 200
            ..|:.:.||||...:::.:..|.:..::.:     .:.||....|:::...:...|.:.|..||.
plant   185 KHRRIINPAFHIEKIKNMVPAFHQSCREVVGEWDQLVSDKGSSCEVDVWPGLVSMTADVISRTAF 249

  Fly   201 GVKLDDMSEGNEYRKAIHDFEI----------VFNQRMCNPLMFFNWYFFL-FGDYKKYSRILRT 254
                     |:.|::....||:          .|.:      .|...|.:| ....::.....|.
plant   250 ---------GSSYKEGQRIFELQAELAQLIIQAFRK------AFIPGYSYLPTKSNRRMKAAARE 299

  Fly   255 IHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAA---EAEGK-IDHQGICDEVNTFM 315
            |.....||:.::.         :..|.|:.....:|..||.:   :.||. :..:.:.:|...|.
plant   300 IQVILRGIVNKRL---------RAREAGEAPSDDLLGILLESNLRQTEGNGMSTEDLMEECKLFY 355

  Fly   316 FGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFP 380
            |.|.:|||..|::|::||:.|.|.|.|..||::.:..| .|......|:|..:..::.|.|||:|
plant   356 FAGQETTSVLLVWTMVLLSQHQDWQARAREEVKQVFGD-KEPDAEGLNQLKVMTMILYEVLRLYP 419

  Fly   381 SAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPK-PNQFLPERFLPE-NSVNRHPFA 443
            ....:.|...:|..:..|.||...|||:.|..:..|...:.. ..:|.|:||... :...:...:
plant   420 PVTQLTRAIHKELKLGDLTLPGGVQISLPILLVQHDIELWGNDAAEFNPDRFKDGLSKATKSQVS 484

  Fly   444 FVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNF 475
            |.||:.|||.||||.|.:||.|:.:|.::|.|
plant   485 FFPFAWGPRICIGQNFALLEAKMAMALILRRF 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 108/454 (24%)
CYP72A15NP_001325567.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.