DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP72A14

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_188086.1 Gene:CYP72A14 / 820696 AraportID:AT3G14680 Length:512 Species:Arabidopsis thaliana


Alignment Length:426 Identity:112/426 - (26%)
Similarity:193/426 - (45%) Gaps:52/426 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 KANGQ-NYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRR 143
            |.:|: |..| |...|...|:..|..:|:|.......|..::.|.: .||.||:.....||...|
plant    90 KTHGRTNLTW-FGPIPTITIMDPEQIKEVFNKVYDFQKAHTFPLSK-ILGTGLVSYDGDKWAQHR 152

  Fly   144 KTLTPAFHFNILQSFLSIFKEESKKFI-----KILDKNVGFELELNQIIPQFTLNNICETALGVK 203
            :.:.||||...:::.:.:|.|...:.:     .:.||....|:::...:...|.:.|..||.   
plant   153 RIINPAFHLEKIKNMVHVFHESCSELVGEWDKLVSDKGSSCEVDVWPGLTSMTADVISRTAF--- 214

  Fly   204 LDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFG-------DYKKYSRILRTIHGFSSG 261
                  |:.||:....||:  ...:...:|.....||:.|       ..::.....|.|.....|
plant   215 ------GSSYREGHRIFEL--QAELAQLVMQAFQKFFIPGYIYLPTKGNRRMKTAAREIQDILRG 271

  Fly   262 IIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAA---EAEGK-IDHQGICDEVNTFMFGGYDTT 322
            || .||::.:        |.|:.....:|..||.:   :.||. :..:.:.:|...|...|.:||
plant   272 II-NKRERAR--------ESGEAPSEDLLGILLESNLGQTEGNGMSTEDMMEECKLFYLAGQETT 327

  Fly   323 STSLIFTLLLLALHADVQERCYEELQ----DLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAP 383
            |..|::|::||:.|.|.|.|..||::    |...|.:.:     |:|..:..::.|.|||:|...
plant   328 SVLLVWTMVLLSQHQDWQARAREEVKQVFGDKQPDTEGL-----NQLKVMTMILYEVLRLYPPVV 387

  Fly   384 IIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPK-PNQFLPERFLPE-NSVNRHPFAFVP 446
            .:.|...:|..:..|.||...|||:.:..:.||...:.. ..:|.||||... :...::..:|.|
plant   388 QLTRAIHKEMKLGDLTLPGGVQISLPVLLVHRDTELWGNDAGEFKPERFKDGLSKATKNQVSFFP 452

  Fly   447 FSAGPRNCIGQKFGVLEIKVLLAAVIR--NFKLLPA 480
            |:.|||.||||.|.:||.|:.::.:::  :|:|.|:
plant   453 FAWGPRICIGQNFTLLEAKMAMSLILQRFSFELSPS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 112/426 (26%)
CYP72A14NP_188086.1 p450 24..512 CDD:299894 112/426 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.