DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP72A8

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_188080.1 Gene:CYP72A8 / 820690 AraportID:AT3G14620 Length:515 Species:Arabidopsis thaliana


Alignment Length:510 Identity:112/510 - (21%)
Similarity:223/510 - (43%) Gaps:88/510 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTPANI---FSY 73
            :...||..:: |:.|.     || :...|:|.   .|:|....|..:.::.....|.|:   :::
plant    29 LNVAWLRPKK-NEAYL-----KR-QGLSGTPF---TFLVGDIKREASMVEQEKSRPINLTDDYTH 83

  Fly    74 ----IRESTAKANGQ-NYIWNFLFAPEYNIV--RAEDAEEIFQSTKITTKNMSYELIRP------ 125
                :.:.|.|.:|: :|:|   ..|..:::  :.|..:::.        |..|:..:|      
plant    84 RVMPLIQQTVKDHGKTSYMW---MGPIASVIVTKPEHIKDVL--------NRVYDFPKPPVHPIV 137

  Fly   126 -FLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFELELNQI--- 186
             ....|:.:...:||...||.:.|:||...|:..:..|.|...:.|...:|.|..:...|:|   
plant   138 ELFATGVALYEGEKWSKHRKIINPSFHLEKLKIMIPAFYESCSEMISKWEKLVTEQGSSNEIDVW 202

  Fly   187 --IPQFTLNNICETALGVKLDDMS-----EGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGD 244
              :...|.:.|..||.|...::..     :..:.|:.:...|:.|...|                
plant   203 PYLGDLTSDVISRTAFGSSYEEGKRIFELQEEQGRRVLKALELAFIPGM---------------- 251

  Fly   245 YKKYSRILRT-----IHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDH 304
                 |.|.|     :...:..:..|.|:...::|.|.  :.|:..:..:|..||.:.:.   ||
plant   252 -----RFLPTKNNLRMRQINKEVKSRLREIIMKRQRGM--DTGEAPKNDLLGILLESNSG---DH 306

  Fly   305 ----QGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNEL 365
                :.:.:|...|.|.|.:||:..|::|:::|:.|...|::..||:..:....::.:....:.|
plant   307 GMSIEDVVEECRLFHFAGQETTAVLLVWTMIMLSHHQKWQDQAREEILKVIGKNNKPNFDALSRL 371

  Fly   366 IHLECVIKESLRLFPSAPIIGRTCIEESVM-NGLVLPKNAQISIHIYDIMRDARHFPKP-NQFLP 428
            ..:..::.|.|||:|...::|||..:|:.: ..:.||..||:.|.:..:.||...:.:. ::|.|
plant   372 KTMSMILNEVLRLYPPGILLGRTVEKETKLGEDMTLPGGAQVVIPVLMVHRDPELWGEDVHEFNP 436

  Fly   429 ERFLPE-NSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIR--NFKLLPA 480
            |||... :...::..:|:||..|||.|.||.|.::|.|:.|..:::  :|:|.|:
plant   437 ERFADGISKATKNQVSFLPFGWGPRFCPGQNFALMEAKMALVLILQRFSFELSPS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 102/471 (22%)
CYP72A8NP_188080.1 p450 26..515 CDD:299894 112/510 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.