DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP72A7

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_188079.1 Gene:CYP72A7 / 820689 AraportID:AT3G14610 Length:512 Species:Arabidopsis thaliana


Alignment Length:408 Identity:107/408 - (26%)
Similarity:177/408 - (43%) Gaps:43/408 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PEYNIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHF----NI 154
            |...|...|..:|:|.......|..::.||| .|..||......||.:.|:.:.||||.    |:
plant   103 PTIVITNPEQIKEVFNKVNDFEKASTFPLIR-LLAGGLASYKGDKWASHRRIINPAFHLEKIKNM 166

  Fly   155 LQSFLSIFKEESKKFIKIL-DKNVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIH 218
            :.:|.....|...::.|:. ||....|:::...:...|.:.|..||.         |:.|::...
plant   167 IPAFYHCCSEVVCQWEKLFTDKESPLEVDVWPWLVNMTADVISHTAF---------GSSYKEGQR 222

  Fly   219 DFEIVFNQRMCNPLMFFNWY-----FFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQV 278
            .|::...........|...|     |:.....::...|.|.:.....||:. ||::.:       
plant   223 IFQLQGELAELIAQAFKKSYIPGSRFYPTKSNRRMKAIDREVDVILRGIVS-KREKAR------- 279

  Fly   279 DEFGKKQRYAMLDTLLAAEAEGKIDHQG-------ICDEVNTFMFGGYDTTSTSLIFTLLLLALH 336
             |.|:.....:|..||.:.:|   :.||       :..|...|.|.|.:|||..|::|::||:.|
plant   280 -EAGEPANDDLLGILLESNSE---ESQGNGMSVEDVMKECKLFYFAGQETTSVLLVWTMVLLSHH 340

  Fly   337 ADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLP 401
            .|.|.|..||:..:..:.::..|...|.|..:..:..|.|||:|....:.|...:|..:..|.||
plant   341 QDWQARAREEVMQVLGENNKPDMESLNNLKVMTMIFNEVLRLYPPVAQLKRVVNKEMKLGELTLP 405

  Fly   402 KNAQISIHIYDIMRDARHF-PKPNQFLPERFLPE-NSVNRHPFAFVPFSAGPRNCIGQKFGVLEI 464
            ...||.:....:.||...: .....|.||||... :...::..:|.||..|||.||||.|.:||.
plant   406 AGIQIYLPTILVQRDTELWGDDAADFKPERFRDGLSKATKNQVSFFPFGWGPRICIGQNFAMLEA 470

  Fly   465 KVLLAAVIR--NFKLLPA 480
            |:.:|.:::  :|:|.|:
plant   471 KMAMALILQKFSFELSPS 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 107/408 (26%)
CYP72A7NP_188079.1 p450 21..512 CDD:299894 107/408 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.