DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP709B2

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:542 Identity:131/542 - (24%)
Similarity:225/542 - (41%) Gaps:102/542 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIGALWLLLRQLNK------TYFIL-SLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTP 67
            :|:...|:|.|:..|      .|.|| ...:.:|....   |:|:.|:.     .|:.|::    
plant    83 ILVWRPWMLSRRFKKQGISGPKYRILYGNLREIRKMKN---EAKLMVLD-----PNSNDIV---- 135

  Fly    68 ANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKIT--TKNMSYELIRPFLGDG 130
            ..:..::::..:: .|:.:::.....|...|...|.|::|. |.|..  :|:.:...|....|:|
plant   136 PRVLPHLQQWKSQ-YGETFLYWQGTDPRLCISDHELAKQIL-SNKFVFFSKSKTKPEILKLSGNG 198

  Fly   131 LLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKE-ESKKFIKILDKNVGFELE----LNQIIPQF 190
            |:......|...|:.|.|||..:.|:....:..: ..:.|::...:..|.|.|    :::...:.
plant   199 LIFVNGLDWVRHRRILNPAFSMDKLKLMTQLMVDCTFRMFLEWKKQRNGVETEQFVLISREFKRL 263

  Fly   191 TLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYF----FLFG-------- 243
            |.:.|...|.         |:.|.:.|..|:.....:.|......:.||    :|..        
plant   264 TADIIATAAF---------GSSYAEGIEVFKSQLELQKCCAAALTDLYFPGIQYLPTPSNLQIWK 319

  Fly   244 -DYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGI 307
             |.|..|.|.|.|..               :...:..::|......||....:.|:|.|:....|
plant   320 LDMKVNSSIKRIIDA---------------RLTSESKDYGNDLLGIMLTAASSNESEKKMSIDEI 369

  Fly   308 CDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEEL-----QDLPEDIDEVSMFQFNELIH 367
            .:|..||.|.|::||:..|.::.:||:||.|.||:..||:     :|...|.:..|..:.     
plant   370 IEECKTFFFAGHETTANLLTWSTMLLSLHQDWQEKLREEVFNECGKDKIPDAETCSKLKL----- 429

  Fly   368 LECVIKESLRLFPSAPIIG--RTCIEESVMNGLVLPKNAQISIHIYDIMRD-ARHFPKPNQFLPE 429
            :..|..|||||:  .|::.  |...|:..:..|.:||...|.:.|..:.|| |......::|.|.
plant   430 MNTVFMESLRLY--GPVLNLLRLASEDMKLGNLEIPKGTTIILPIAKMHRDKAVWGSDADKFNPM 492

  Fly   430 RFLPENSVNR---HPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKL--------LPATQL 483
            ||  .|.::|   ||.|.:.||.|||.||||.|.::|.|.:||.:::.|:|        .||..|
plant   493 RF--ANGLSRAANHPNALLAFSMGPRACIGQNFAIMEAKTVLAMILQRFRLNLSADYKHAPADHL 555

  Fly   484 EDLTFENGIVLRTQQNIKVKFE 505
                     .|:.|.::.|..|
plant   556 ---------TLQPQYDLPVILE 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 118/491 (24%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 130/536 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.