DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP704A1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_850427.2 Gene:CYP704A1 / 819098 AraportID:AT2G44890 Length:511 Species:Arabidopsis thaliana


Alignment Length:484 Identity:115/484 - (23%)
Similarity:206/484 - (42%) Gaps:98/484 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 FVVPGKTRFGNNLDLLNLTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTK 112
            |:.||::      ::....|.|:     |...|....||                      ....
plant    73 FLSPGQS------EIFTADPRNV-----EHILKTRFHNY----------------------SKGP 104

  Fly   113 ITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSF-LSIFKEESKKFIKILDKN 176
            :.|.|::     ..||.|:.....:||..:||.::..|...:|::| .|:|:..:.|.:..:.:.
plant   105 VGTVNLA-----DLLGHGIFAVDGEKWKQQRKLVSFEFSTRVLRNFSYSVFRTSASKLVGFIAEF 164

  Fly   177 V--GFELELNQIIPQFTLNNICETALGVK---LDDMS-EGNEYRKAIHDFEIVFNQRMCNPLMFF 235
            .  |...:...::.:.||::|.:...||:   ||..| ||.|:.||..:.....:.|:.:|  |:
plant   165 ALSGKSFDFQDMLMKCTLDSIFKVGFGVELGCLDGFSKEGEEFMKAFDEGNGATSSRVTDP--FW 227

  Fly   236 NWYFFL-FGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAE 299
            ....|| .|...:..:.:..|..|...:|..||::..::|...|.|          |.|.....|
plant   228 KLKCFLNIGSESRLKKSIAIIDKFVYSLITTKRKELSKEQNTSVRE----------DILSKFLLE 282

  Fly   300 GKIDHQGICDE-----VNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPED------ 353
            .:.|.:.:.|:     :...|..|.|||:.||.:.|.:|..:..|||:..:|::|:...      
plant   283 SEKDPENMNDKYLRDIILNVMVAGKDTTAASLSWFLYMLCKNPLVQEKIVQEIRDVTSSHEKTTD 347

  Fly   354 ----IDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQIS--IHIYD 412
                |:.|:.....::.:|...:.|::||:|..|...| |.|    |..|||...::|  .:||.
plant   348 VNGFIESVTEEALAQMQYLHAALSETMRLYPPVPEHMR-CAE----NDDVLPDGHRVSKGDNIYY 407

  Fly   413 IM-----------RDARHFPKPNQFLPER-FLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIK 465
            |.           :||..| ||.::|.:. |.||:.     |.|:.|.||||.|||:.|...::|
plant   408 ISYAMGRMTYIWGQDAEEF-KPERWLKDGVFQPESQ-----FKFISFHAGPRICIGKDFAYRQMK 466

  Fly   466 VLLAAVIRNFKLLPATQLEDLTFENGIVL 494
            ::..|::..|:...|.:...::::..:.|
plant   467 IVSMALLHFFRFKMADENSKVSYKKMLTL 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 114/481 (24%)
CYP704A1NP_850427.2 CYP86A 69..501 CDD:410687 115/484 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.