DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:538 Identity:157/538 - (29%)
Similarity:248/538 - (46%) Gaps:106/538 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LIGALWLLLRQLNKTYFILSLCKRVR-TADGSPLESKVFVVP------GKTRF--GNNLDLLN-- 64
            |:..|.|:|.|..|.|.     :|.| ..|.||     |..|      |..:|  .:|::.|:  
Mouse    18 LVFCLALVLMQAMKLYL-----RRQRLLRDLSP-----FPGPPAHWLLGHQKFLQEDNMETLDEI 72

  Fly    65 -----------LTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNM 118
                       :.|...|.||                 :.|:|        .:||.|.  |...|
Mouse    73 VKKHPCAFPCWVGPFQAFFYI-----------------YDPDY--------AKIFLSR--TDPKM 110

  Fly   119 SY--ELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFE- 180
            .|  :|:.|.:|.|||.....:|...|..||||||.:||:..:.......|   .:|||   :| 
Mouse   111 QYLHQLLTPCIGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVK---VMLDK---WEK 169

  Fly   181 --------LELNQIIPQFTLNNICETALGVKLDDMSEG--NEYRKAIHDFEIVFNQRMCNPLMFF 235
                    :|:.:.|...||:.|.:.|.|.:.:....|  ..|.||..:...:.:.|:.|   |:
Mouse   170 MWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYN---FW 231

  Fly   236 NWYFFLFGDYKK---YSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAE 297
            :.:..:|....|   :..:.:.||.::..|||.:::..|    .||.:...:.....||.:|:|:
Mouse   232 HHHDIIFKLSPKGHCFQELGKVIHQYTEKIIQDRKKILK----NQVKQDDTQTSQIFLDIVLSAQ 292

  Fly   298 AEGKIDHQGICD-----EVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEV 357
            ||   |.:...|     ||||||:.|:|.::.|:.:.|..|||:.:.|:||..|::.:..|...:
Mouse   293 AE---DERAFSDADLRAEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSI 354

  Fly   358 SMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFP 421
            :..|.:|:.:....|||:|||.|..|.|.|...:. ::.:|..||....:.:.|:.:..:...:.
Mouse   355 TWEQLDEMSYTTMCIKETLRLIPPVPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWN 419

  Fly   422 KPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDL 486
            .|..|.|.||..|||..|||.||:|||:||||||||:|.:||:||.:|.::.:|::.|     ||
Mouse   420 DPKVFDPLRFTKENSDQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALILLHFQVAP-----DL 479

  Fly   487 T----FENGIVLRTQQNI 500
            |    |.:..|||.:..|
Mouse   480 TRPPAFSSHTVLRPKHGI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 144/497 (29%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 144/499 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.