DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP96A1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_179899.1 Gene:CYP96A1 / 816850 AraportID:AT2G23180 Length:516 Species:Arabidopsis thaliana


Alignment Length:531 Identity:120/531 - (22%)
Similarity:220/531 - (41%) Gaps:93/531 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IGALWLLLRQLNKTY-FILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLD-LLNLTPANIFSYI 74
            :|.|..||.::.:.| |:..|           ||:.....|.|......|| |:.:.||||...:
plant    40 LGMLPGLLVEIPRVYDFVTEL-----------LEASNLTYPFKGPCFGGLDMLITVDPANIHHIM 93

  Fly    75 RESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKW 139
                 .:|..||                            .|...::.|...||||:..:..:.|
plant    94 -----SSNFANY----------------------------PKGTEFKKIFDVLGDGIFNADSELW 125

  Fly   140 HTRRKTLTPAFHFNILQSFL--SIFKEESKKFIKILD-----KNVGFELELNQIIPQFTLNNICE 197
            ...||:..........|.|.  :|..:..|..:.:||     |.|   ::|..:..:||.:....
plant   126 KDLRKSAQSMMTHQDFQRFTLRTIMSKLEKGLVPLLDYVAEKKQV---VDLQDVFQRFTFDTSFV 187

  Fly   198 TALGVK---LDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFL-FGDYKKYSRILRTIHGF 258
            .|.||.   |.......|:.:|:.:.|.....|...|.:.:....|: |||..|..:...|....
plant   188 LATGVDPGCLSTEMPQIEFARALDEAEEAIFFRHVKPEIVWKMQRFIGFGDELKMKKAHSTFDRV 252

  Fly   259 SSGIIQRKRQQFKQKQLGQVDEFGKK--QRYAMLDTLLAAEAEGKI----DHQGICDEVNTFMFG 317
            .|..|..||.:.....: .:|...|.  ..|..:|| :....:.|:    |.:.:.|.:.:||..
plant   253 CSKCIASKRDEITNGVI-NIDSSSKDLLMCYMNVDT-ICHTTKYKLLNPSDDKFLRDMILSFMLA 315

  Fly   318 GYDTTSTSLIFTLLLLALH----ADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRL 378
            |.||||::|.:...||:.:    ..:::....:|.....|.|..:..:.|:|:::...:.|:|||
plant   316 GRDTTSSALTWFFWLLSKNPKAITKIRQEINTQLSPRTNDFDSFNAQELNKLVYVHGALCEALRL 380

  Fly   379 FPSAPIIGRTCIEESVM-NGLVLPKNAQISIHIYDIMR-------DARHFPKPNQFLPERFLPEN 435
            :|..|...::..:..|: :|..:..:::|...:|.:.|       ||      ::|.|||::.|:
plant   381 YPPVPFQHKSPTKSDVLPSGHRVDASSKIVFCLYSLGRMKSVWGEDA------SEFKPERWISES 439

  Fly   436 S--VNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNF--KLLPATQLEDLTFENGIVLRT 496
            .  ::...|.|:.|:||||.|:|::..:.::|.:...:|:|:  |::...::|.:.   .|:|..
plant   440 GRLIHVPSFKFLSFNAGPRTCLGKEVAMTQMKTVAVKIIQNYEIKVVEGHKIEPVP---SIILHM 501

  Fly   497 QQNIKVKFEAR 507
            :..:||....|
plant   502 KHGLKVTVTKR 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 110/486 (23%)
CYP96A1NP_179899.1 p450 1..512 CDD:299894 119/529 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 151 1.000 Domainoid score I1385
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.