DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and cyp46a1.3

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001038763.1 Gene:cyp46a1.3 / 692332 ZFINID:ZDB-GENE-060519-40 Length:491 Species:Danio rerio


Alignment Length:482 Identity:124/482 - (25%)
Similarity:220/482 - (45%) Gaps:73/482 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LWLLLRQLNKTYFI-LSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTPANIFSYIREST 78
            |:::...|:..:.: |:.|..:.     .:..|...:||..|  :|. ||...|.  .:.:.:|.
Zfish     7 LYMVFYLLSAVFVVFLAYCLYIH-----QVHQKYDHIPGPPR--DNF-LLGHIPT--INRVTKSE 61

  Fly    79 AKANGQNYIWNFLFAPEY----------NIVRAEDAEEIFQSTKITTKNMSYELI-----RPFLG 128
            ...|....||...:.|.|          |:...|..:.|..|.|.......|:.:     :.|||
Zfish    62 RHMNDLLLIWAEKYGPVYRLNSFHYVIINVHCPEATKTIMMSPKYLKDPFIYKRLFGLFGKRFLG 126

  Fly   129 DGLLISIDQK-WHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFELELNQ------- 185
            .||:.:.|.. |:.:|:.:.|||..:.|:..:|.|.|.|::.:..|:     |:.:|:       
Zfish   127 YGLVTATDHDIWYRQRRIMDPAFSSSYLRGLISTFNEMSERLMDKLE-----EMAINKTPAVMHD 186

  Fly   186 IIPQFTLNNICETALGVKLDDMSE-GNEYRKAIHDF--EIVFNQR--MCNPLMFF--NWYFFLFG 243
            ::...||:.||:.|.||.|:...: .|.:::||...  .:|.:.|  .|.   ||  ||      
Zfish   187 LVNCVTLDIICKVAFGVDLNLFKQTDNPFQQAIEQCLQGMVLDLRDPFCK---FFPKNW------ 242

  Fly   244 DYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKI----DH 304
                  :.::...| ::.::::..:|:.|.:...| |.|:.....:|..:|....|.|:    ||
Zfish   243 ------KAIQETKG-ATVLLRKTGEQWIQNRKTAV-EIGEDVPNDILTQILKTAKEEKVNNTKDH 299

  Fly   305 QGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLE 369
            :.:.|...||...|.:||:..|.|.::.|..|.::.:|...|:.::.....::|.....:..:|.
Zfish   300 EQMLDNFVTFFIAGQETTANQLSFAIMELGRHPEIYKRAKAEVDEVLGTKRDISYEDLGKFTYLS 364

  Fly   370 CVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPE 434
            .|:||:|||:|:||...|...|:.|:||:.:|....:....|...|..:||..|.:|.||||   
Zfish   365 QVLKETLRLYPTAPGTNRWLHEDMVINGIKIPGGISVIFSSYVAQRLEKHFKDPLKFDPERF--- 426

  Fly   435 NSVN--RHPFAFVPFSAGPRNCIGQKF 459
             :||  :..:.:.|||.|||:|:||.|
Zfish   427 -NVNAPKPYYCYYPFSLGPRSCLGQVF 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 119/445 (27%)
cyp46a1.3NP_001038763.1 p450 39..452 CDD:278495 118/443 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.