DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP3A43

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_073731.1 Gene:CYP3A43 / 64816 HGNCID:17450 Length:504 Species:Homo sapiens


Alignment Length:401 Identity:102/401 - (25%)
Similarity:187/401 - (46%) Gaps:35/401 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNV--GFELELNQIIP 188
            ||...|..:.|::|...|..|:|||.....:..:.|..:.....::.|.:..  ...:.|.....
Human   113 FLKSALSFAEDEEWKRIRTLLSPAFTSVKFKEMVPIISQCGDMLVRSLRQEAENSKSINLKDFFG 177

  Fly   189 QFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILR 253
            .:|::.|..|..||.||.::...:        ..:.|.:....|.|.:.:..|...:...:.:..
Human   178 AYTMDVITGTLFGVNLDSLNNPQD--------PFLKNMKKLLKLDFLDPFLLLISLFPFLTPVFE 234

  Fly   254 TI----------HGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGIC 308
            .:          |...:.|.:.|..:.|.||..:||.|.:     |:|:..:.|.:   .|:.:.
Human   235 ALNIGLFPKDVTHFLKNSIERMKESRLKDKQKHRVDFFQQ-----MIDSQNSKETK---SHKALS 291

  Fly   309 D-----EVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHL 368
            |     :....:|..||||||:|.|.:..||.|.|||::..||:..:..:...|:.....::.:|
Human   292 DLELVAQSIIIIFAAYDTTSTTLPFIMYELATHPDVQQKLQEEIDAVLPNKAPVTYDALVQMEYL 356

  Fly   369 ECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPE-RFL 432
            :.|:.|:|||||....:.|.|.::..:||:.:||...:.:.||.:..|.:::.:|.:|.|| ||.
Human   357 DMVVNETLRLFPVVSRVTRVCKKDIEINGVFIPKGLAVMVPIYALHHDPKYWTEPEKFCPESRFS 421

  Fly   433 PENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLE-DLTFENGIVLRT 496
            .:|..:...:.::||.||||||||.:|.:..||:.:...::||...|..:.: .|..:|..:|:.
Human   422 KKNKDSIDLYRYIPFGAGPRNCIGMRFALTNIKLAVIRALQNFSFKPCKETQIPLKLDNLPILQP 486

  Fly   497 QQNIKVKFEAR 507
            ::.|.:|...|
Human   487 EKPIVLKVHLR 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 100/396 (25%)
CYP3A43NP_073731.1 p450 39..494 CDD:278495 100/396 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.