DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP4F11

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001122404.1 Gene:CYP4F11 / 57834 HGNCID:13265 Length:524 Species:Homo sapiens


Alignment Length:525 Identity:167/525 - (31%)
Similarity:263/525 - (50%) Gaps:55/525 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLES-----KVFVVPGKTRFGNNLD 61
            |:.|    ||:|..|||.|.|..||.....|:|::.....|.::     :..|.|.:........
Human    19 WLLL----LLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMKTLTQ 79

  Fly    62 LLNLTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNM-SYELIRP 125
            |:...|.....::        |..:....|..|:  |:|...:    .|..:..|:| .|..::|
Human    80 LVTTYPQGFKLWL--------GPTFPLLILCHPD--IIRPITS----ASAAVAPKDMIFYGFLKP 130

  Fly   126 FLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKIL-DK------NVGFELEL 183
            :||||||:|...||...|:.||||||||||:.::.||    .|.:.|: ||      .....|::
Human   131 WLGDGLLLSGGDKWSRHRRMLTPAFHFNILKPYMKIF----NKSVNIMHDKWQRLASEGSARLDM 191

  Fly   184 NQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKY 248
            .:.|...||:::.:.....:.:...:.:||..||.:......:|....|:..::.::|..|.:::
Human   192 FEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAILELSAFVEKRNQQILLHTDFLYYLTPDGQRF 256

  Fly   249 SRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGK-KQRYAMLD----TLLAAEAEGK-IDHQGI 307
            .|....:|.|:..:||.:|.....:   .:|:|.| |.:...||    .||:.:.:|| :..:.|
Human   257 RRACHLVHDFTDAVIQERRCTLPTQ---GIDDFLKNKAKSKTLDFIDVLLLSKDEDGKELSDEDI 318

  Fly   308 CDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDID--EVSMFQFNELIHLEC 370
            ..|.:||||.|:|||::.|.:.|..||.|.:.||:|.:|:|:|.:|.:  |:......:|..|..
Human   319 RAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDLAQLPFLTM 383

  Fly   371 VIKESLRLFPSAPIIGRTCIEESVM-NGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPE 434
            .|||||||.|..|:|.|.|.::.|: :|.|:||.....|:|..|..:...:|.|..:.|.||..|
Human   384 CIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFDQE 448

  Fly   435 NSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLED-------LTFENGI 492
            |...|.|.||:||||||||||||.|.:.|:||:||..:.:|::|| |..|.       |..|.|:
Human   449 NIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILP-THTEPRRKPELILRAEGGL 512

  Fly   493 VLRTQ 497
            .||.:
Human   513 WLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 151/471 (32%)
CYP4F11NP_001122404.1 p450 52..506 CDD:365848 148/475 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.