DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and cyp4f2

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:433 Identity:137/433 - (31%)
Similarity:240/433 - (55%) Gaps:39/433 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 PEYNIVRAEDAEEIF-QSTKITTKN-MSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQ 156
            ||.::|..:..:.:. .|..|..|: :.|..:||:||||||:|..:||...|:.|||||||:||:
 Frog   104 PEVSLVHPDTVKPVVAASAAIAPKDELFYGFLRPWLGDGLLLSRGEKWGQHRRLLTPAFHFDILK 168

  Fly   157 SFLSIFKEESKKFI---KILDKNVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIH 218
            :::.||.:.:...:   :.|.......|::.:.:...||:.:.:.......|...:.::|..||:
 Frog   169 NYVKIFNQSTDIMLAKWRRLTAEGPVSLDMFEHVSLMTLDTLLKCTFSYDSDCQEKPSDYISAIY 233

  Fly   219 DFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQ--VDEF 281
            :...:..:|.......|::.:.|..:.:|:.:..:|:|.|::|::|::::..::|.:.:  ..:.
 Frog   234 ELSSLVVKREHYLPHHFDFIYNLSSNGRKFRQACKTVHEFTAGVVQQRKKALQEKGMEEWIKSKQ 298

  Fly   282 GKKQRYAMLDTLLAAEAE--GKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCY 344
            ||.:.:  :|.||.::.|  .::..:.:..||:||||.|:|||::.|.:.|..||.|.:.||:|.
 Frog   299 GKTKDF--IDILLLSKNEDGSQLSDEDMRAEVDTFMFEGHDTTASGLSWILYNLACHPEYQEKCR 361

  Fly   345 EELQDLPE--DI-----DEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEE-SVMNGLVLP 401
            :|:.:|.|  ||     ||:|...|..:    | |||||||.|....:.|.|.|: .:..|.:||
 Frog   362 KEITELLEGKDIKHLEWDELSKLPFTTM----C-IKESLRLHPPVVAVIRRCTEDIKLPKGDILP 421

  Fly   402 KNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKV 466
            |.....|:|:.|..:...:|.|..:.|.||.|||...|..:|||||||||||||||.|.:.|:|:
 Frog   422 KGNCCIINIFGIHHNPDVWPNPQVYDPYRFDPENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKI 486

  Fly   467 LLAAVIRNFKLLPATQLED-----------LTFENGIVLRTQQ 498
            :||.::.||::    :|::           |..|||:.|:.::
 Frog   487 VLALILYNFQV----RLDETKTVRRKPELILRAENGLWLQVEE 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 137/433 (32%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 132/419 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.