DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and sad

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster


Alignment Length:191 Identity:52/191 - (27%)
Similarity:90/191 - (47%) Gaps:18/191 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 AMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPE 352
            |:...|.||:..|.:..:...|    .:....|||:.|..:.|..|:....:|:|..:|...   
  Fly   316 ALYHRLQAADVPGDMIKRIFVD----LVIAAGDTTAFSSQWALFALSKEPRLQQRLAKERAT--- 373

  Fly   353 DIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDA 417
                      |:...:..:|||||||:|.||.|||...:::.:.|..:.|:..:.:.:|...||.
  Fly   374 ----------NDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDP 428

  Fly   418 RHFPKPNQFLPERF-LPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKL 477
            .||.:|.:.||||: :.|..........:||:.|.|:|||::..:.::..||......|::
  Fly   429 SHFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEM 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 52/191 (27%)
sadNP_650123.1 p450 63..497 CDD:299894 52/191 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.