DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and cyp-25A3

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001040850.1 Gene:cyp-25A3 / 4363046 WormBaseID:WBGene00014697 Length:502 Species:Caenorhabditis elegans


Alignment Length:450 Identity:105/450 - (23%)
Similarity:197/450 - (43%) Gaps:76/450 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NIVRAEDAEEIFQSTKITTKNMSYELIR---PFLGDG------LLISIDQKWHTRRKTLTPAF-- 150
            ||...||.:|:|      .||.|....|   |.:.|.      |..:.:..|...|..:.|.|  
 Worm    89 NITNEEDIKEVF------IKNFSNFSDRTPPPIIEDNKLKESLLQNTYESGWKHTRSAIAPIFST 147

  Fly   151 ------HFNI---LQSFLSIFKEESKKFIKILDKNVGFELELNQIIPQFTLNNICETALGVKLDD 206
                  |..|   :..||.|.||::..         |.:.::.......||:.|.:.|..:..:.
 Worm   148 GKMKAMHETIHSKVDLFLEILKEKASS---------GQKWDIYDDFQGLTLDVIGKCAFAIDSNC 203

  Fly   207 MSEGNEY-----RKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHGFSSG---II 263
            ..:.|:.     ||.|.:.:|..::.:...        |||.:..|..::|......:..   ::
 Worm   204 QRDRNDVFYVNARKFITNIDIRHSKIISTS--------FLFPELSKLWKVLYRFTDLAKAEIPLV 260

  Fly   264 QRKRQQFKQKQLGQ----VDEFGKKQRYAMLDTLLAAEAEGK--IDHQGICDEVNTFMFGGYDTT 322
            :.....:::::.|:    ||         :|..||..|.:..  :..|.:.:....|:..||:||
 Worm   261 EGLADVYERRRGGEGSDSVD---------LLKLLLNREDDKSKPMTKQEVIENCFAFLLAGYETT 316

  Fly   323 STSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPII-- 385
            ||::.:...||:.:.:||::.|||:.:..|: ..::....:.:.:|:.|.||:||.:|  |:|  
 Worm   317 STAMTYCSYLLSKYPNVQQKLYEEIMEAKEN-GGLTYDSIHNMKYLDYVYKETLRCYP--PVIHF 378

  Fly   386 -GRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPEN-SVNRHPFAFVPFS 448
             .|.|:::..:.|...||.|.:....:.:.|:..::..|.:|.||||  || ........::||.
 Worm   379 SNRRCLKDITIRGQFYPKGAIVVCLPHTVHRNPENWDSPEEFHPERF--ENWEEKSSSLKWIPFG 441

  Fly   449 AGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFE-NGIVLRTQQNIKVKFEAR 507
            .|||.|:|.:|..:|.|..:|.::..|:|.......||..: ||:::|.:..:::..:.|
 Worm   442 VGPRYCVGMRFAEMEFKTTIAKLLDTFELKQFEGEADLIPDCNGVIMRPKDPVRLHLKPR 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 104/445 (23%)
cyp-25A3NP_001040850.1 p450 37..496 CDD:278495 104/443 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.