DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp313a1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_650368.1 Gene:Cyp313a1 / 41759 FlyBaseID:FBgn0038236 Length:492 Species:Drosophila melanogaster


Alignment Length:531 Identity:137/531 - (25%)
Similarity:238/531 - (44%) Gaps:80/531 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLIGAL-WL-LLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNLDLLNLTPANIFS 72
            |.:||| |: .|....:.||::                  ..:||..    .|.:|..:..||.:
  Fly     8 LAVGALFWIYFLWSRRRLYFLM------------------LKIPGPI----GLPILGSSLENIIT 50

  Fly    73 YIRESTAKANGQN------YIW----NFLFAPEYNIVRAEDAEEIFQSTKITTKNMS-YELIRPF 126
            |.|:.:.:....|      ..|    .|:...:..:|     |:||.|.....|:.. ...|...
  Fly    51 YKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPKVV-----EDIFSSPDCHNKSQHIVNAITSC 110

  Fly   127 LGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVG-FELELNQIIPQF 190
            :|:|||...|..|..|||...|:|..::|.||..||..|:|..:.:||..|. .|:::...:.::
  Fly   111 MGNGLLGKQDPHWLDRRKHFNPSFKQDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRW 175

  Fly   191 TLNNICETALG--VKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILR 253
            :.....:|.:|  ||.|:..:..   ..:..||.:.:....|.||..           ..:|::.
  Fly   176 SFKIAAQTTMGSEVKHDEHFKNG---SLVESFESLISHSTLNILMPL-----------VQNRMIS 226

  Fly   254 TIHGFSSGIIQRKRQQFK--QKQLGQVDEFGKK-----------QRYAMLDTLLAAEAEGKIDHQ 305
            .|.|:.    :.:...|.  ||.|..|  ..||           :...:::..:....:|.|.:.
  Fly   227 KICGYD----KLRADNFSRIQKMLDNV--VNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYM 285

  Fly   306 GICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDE--VSMFQFNELIHL 368
            .:..|....:..||||::.::...|.|||.|.:.||..:|||..:..|...  ::.....:|.:|
  Fly   286 DVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAGHFGITYPDMQKLDYL 350

  Fly   369 ECVIKESLRLFPSAPIIGR-TCIEESVMNGLVLPKNAQISIHIYDIMRDARHF-PKPNQFLPERF 431
            |.||||:|||.|:.||..| |..:..:.||:::||...|.|.::...|:...: |..:.|.|:.|
  Fly   351 ERVIKETLRLIPAIPITARETKNDVRLSNGVLIPKGVVIGIDMFHTHRNPEVWGPDADNFNPDNF 415

  Fly   432 LPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENGIVLRT 496
            |.||...:||:|::||:.|.|||||.|:.::..|..|..::||:|:..:|..:||.:.:.:.::.
  Fly   416 LAENMEQKHPYAYIPFARGKRNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKL 480

  Fly   497 QQNIKVKFEAR 507
            .:..::|.:.|
  Fly   481 AEYPRLKLQRR 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 127/483 (26%)
Cyp313a1NP_650368.1 p450 33..463 CDD:299894 124/458 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
43.960

Return to query results.
Submit another query.