DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp316a1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_648129.2 Gene:Cyp316a1 / 38840 FlyBaseID:FBgn0035790 Length:484 Species:Drosophila melanogaster


Alignment Length:462 Identity:110/462 - (23%)
Similarity:228/462 - (49%) Gaps:39/462 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LLNLTPANIFSYIRESTAKANGQNYIWNF--LFAPEYNIVRAEDAEEIFQS-TKITTKNMSYELI 123
            ||.|||.|.|....|...|....:..|.|  ||.|   :...|.:.::.:: |.:.|   .|||:
  Fly    46 LLFLTPINFFQRSTEYLTKYGTFSRCWVFHRLFIP---LADLELSRQLLENDTHLET---GYELM 104

  Fly   124 RPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFEL-ELNQII 187
            :.:|..|:|:...::|..|...::..|....|:..:.:.:.::::.::.|.|....:: ::...:
  Fly   105 KDWLVGGVLMCQSEQWQKRHSLISGLFDKGNLEQLIDLSRHQTEQLLQKLAKQADQKVFDIWYTV 169

  Fly   188 PQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDY--KKYSR 250
            ....|:.:..|..|.|     ...||.|.:.|...::.:|..:......:.::|...:  |:.:|
  Fly   170 SPIVLDLMVMTTCGAK-----PSEEYSKNLKDLSEIYRKRFLSLQSANRFNYWLSSPFMRKRQNR 229

  Fly   251 ILRTIHGFSSGIIQRKRQQFKQK-----QLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDE 310
            :::.::...:.::...:.|.:.|     .:.|:.....|...::|:.||.:: :.::..:.||.|
  Fly   230 LIKRLNDEHNNLMAMHQSQNQLKIENGLDIYQLRPIPLKDHKSLLEILLESK-DPQLTGEEICGE 293

  Fly   311 VNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKES 375
            :||..:.||...|.:|.|.|:.:|.:..||::|.:|| :|.:..|:  .:...:|.:|:.|:.|:
  Fly   294 LNTCNYLGYQLCSPALCFCLVTIARNPSVQQKCLDEL-NLAQIKDQ--GWDLEKLNYLDAVLHET 355

  Fly   376 LRLFPSAPIIGRTCIEE-----SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPEN 435
            :||:|...|:||...::     |::....||..::|.|::|::.|:...:||.|.|..:|||.. 
  Fly   356 MRLYPPQVIVGRQLKKDFPYTHSIVGDAELPCGSEIYINLYELQRNEVRYPKANHFDAQRFLDS- 419

  Fly   436 SVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENGIVLRTQQNI 500
                 |...:.:|.|||.|..:||.:..:|.|||.::.||::||..  :::..:..:||.:....
  Fly   420 -----PPELLSYSLGPRCCPARKFSMQLLKTLLAPILANFEVLPYG--DEVRLDLRLVLGSSNGF 477

  Fly   501 KVKFEAR 507
            ::..:.|
  Fly   478 QLALKPR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 109/457 (24%)
Cyp316a1NP_648129.2 p450 33..466 CDD:299894 107/442 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 101 1.000 Domainoid score I1781
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I1639
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.