DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp6a23

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_611000.2 Gene:Cyp6a23 / 36661 FlyBaseID:FBgn0033978 Length:502 Species:Drosophila melanogaster


Alignment Length:398 Identity:106/398 - (26%)
Similarity:182/398 - (45%) Gaps:47/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LISID-QKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNV----GFELELNQIIPQFT 191
            |.||: |||...|..|||.|....:::...|..:..::..||.....    |..||:..::.::|
  Fly   118 LFSIEGQKWRHLRHKLTPTFTSGKMKNMFPIIVKVGEEMEKIFSAKTTTGEGQVLEIVDLVARYT 182

  Fly   192 LNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILR--- 253
            .:.|...|.|:..:.:...|.....|....|:  :|....|:    .|.:|| :.|.||.||   
  Fly   183 ADVIGNCAFGLNCNSLQNPNAEFVTIGKRAII--ERRYGGLL----DFLIFG-FPKLSRRLRLKL 240

  Fly   254 ---TIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLL-------AAEAEGKIDHQGIC 308
               .:..|.:.|: |....::.:.        .::|:..:|:|:       |...|..:....|.
  Fly   241 NVQDVEDFYTSIV-RNTIDYRLRT--------NEKRHDFMDSLIEMYEKEQAGNTEDGLSFNEIL 296

  Fly   309 DEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQD-LPEDIDEVSMFQFNELIHLECVI 372
            .:...|...|::|:||::.|.|..|||..|:|::...|:.: |.:..:|.:.....|:.:||.|:
  Fly   297 AQAFIFFVAGFETSSTTMGFALYELALDQDIQDQLRAEINNVLSKHNNEFTYEGIKEMKYLEQVV 361

  Fly   373 KESLRLFP-SAPIIGRTCIEESVMN-GLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPEN 435
            .|:||.:| .|.:...|..:.|..: ...:.|...:.|....|..|...:|:|.:|.||||..|.
  Fly   362 METLRKYPVLAHLTRMTQTDFSPEDPKYFIAKGTTVVIPALGIHYDPEIYPEPEKFKPERFTDEA 426

  Fly   436 SVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLED----------LTFEN 490
            ...|....::||..|||||||.:||:::..|.||.:||.:|...:|:.:.          |:.||
  Fly   427 IAARPSCTWLPFGEGPRNCIGLRFGLMQACVGLAYLIRGYKFSVSTETQIPMKFVVKSILLSAEN 491

  Fly   491 GIVLRTQQ 498
            ||.|:.::
  Fly   492 GIHLKVEK 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 106/398 (27%)
Cyp6a23NP_611000.2 p450 36..495 CDD:278495 105/392 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.