DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:584 Identity:142/584 - (24%)
Similarity:234/584 - (40%) Gaps:149/584 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IALLGSSLLIGAL--------WLLLRQLN-------KTYFILSLCKRVRTADGSPLESKVFVVPG 52
            |||.....|:..|        |.|:.|||       :....|.||  :.....|.||.   |...
  Fly     5 IALWACGALLAVLLAWQQRKCWRLIWQLNGWRGVIQQPVLWLLLC--INLHPNSILEK---VSQY 64

  Fly    53 KTRFGNNLDLLNLTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKN 117
            :..|...|.:  |....:..||.:..    |...:.|   |||.                     
  Fly    65 RVHFQRPLAV--LVGTRVLLYIDDPA----GMECVLN---APEC--------------------- 99

  Fly   118 MSYELIRPFLGD------GLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKN 176
                |.:.||.|      |||.:..|||..|||.|.|||..||:.||..:|            .:
  Fly   100 ----LDKTFLQDGFFVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVF------------NS 148

  Fly   177 VGFELELNQIIPQF-TLNNI----------------------CETALG-----VKLDDMSEGNEY 213
            ||     ||::.|| |..|:                      |.|.:|     .:|||....:.|
  Fly   149 VG-----NQMVEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSY 208

  Fly   214 RKAIHDFEIVFNQRMCNPLMFFNWYFFLFGD--YKKYSRILRTIHGFSSGIIQRKRQQFKQKQLG 276
            ::.:.    :...|:..|.:.......|...  |::..:..:.:..|..||::.|.:.::.:...
  Fly   209 KRLLE----ISAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAV 269

  Fly   277 QVDEFGKK-----QRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALH 336
            ..::.|:.     ||...::.:....|.|::..:.|.||..:.:...::|.|.|::..||.||.:
  Fly   270 GGEKSGEDASNGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATN 334

  Fly   337 -ADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNG--- 397
             .|.|.|...|::.|..|:.:|.:.|..:|.:|:..:.|||||..:.|:..|....:..:.|   
  Fly   335 KGDCQRRLLAEIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQH 399

  Fly   398 -LVLPKNAQISIHIYDIMRDARHF-PKPNQFLPERFLPENSV-------------------NRHP 441
             .::|:|:.:.:..:::.||.|.: ....||.|:|||.:...                   .||.
  Fly   400 ETIVPQNSIVVLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHS 464

  Fly   442 FAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENGIVLRTQQNIKVKFE 505
            ::|:|||.|.|:|||:::|:..:||.|..:|.||......:||.|.|        .:||.:||:
  Fly   465 YSFLPFSNGLRSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQF--------VENISLKFK 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 123/518 (24%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 124/520 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1605
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.