DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4a3

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_038965516.1 Gene:Cyp4a3 / 298423 RGDID:631356 Length:511 Species:Rattus norvegicus


Alignment Length:410 Identity:126/410 - (30%)
Similarity:210/410 - (51%) Gaps:48/410 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 YELIRPFL----GDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKN 176
            |:.:.|::    |.|||:...:||....:.||||||:.||:.::.|..:...    |:.|:.|::
  Rat   117 YQFLAPWIVSGTGYGLLLLNGKKWFQHWRMLTPAFHYGILKPYVKIMADSVSIMLDKWEKLDDQD 181

  Fly   177 VGFELELNQIIPQFTLNNICETAL----GVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNW 237
              ..||:...:...||:.:.:.|.    .|:||..|  ..|.||:.|.         |.|.||..
  Rat   182 --HPLEIFHYVSLMTLDTVMKCAFSHQGSVQLDVNS--RSYTKAVEDL---------NNLTFFRV 233

  Fly   238 YFFLFGDYKKYS---------RILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTL 293
            ....:|:...|:         |..:..|..:.|:|:.::.|.:.::  ::.:..||:....||.|
  Rat   234 RSAFYGNSIIYNMSSDGRLSRRACQIAHEHTDGVIKMRKAQLQNEE--ELQKARKKRHLDFLDIL 296

  Fly   294 LAAEAE-GK-IDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDE 356
            |.|:.| || :..:.:..||:||||.|:|||::.:.:....||.|.:.||||.||:|.:..|...
  Rat   297 LFAKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGDGTS 361

  Fly   357 VSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHF 420
            |:....:::.:....|||:|||:|..|.:.|..... :..:|..:||....:|.||.:..:..::
  Rat   362 VTWDHLDQISYTTMCIKEALRLYPPVPSVSRELSSPVTFPDGRSIPKGITTTILIYGLHHNPSYW 426

  Fly   421 PKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP-ATQLE 484
            |.|..|.|.||.|::.  ||..|::|||.|.|||||::|.:.|:||.:|..:..|:||| .|::.
  Rat   427 PNPKVFDPSRFSPDSP--RHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRIP 489

  Fly   485 ------DLTFENGIVLRTQQ 498
                  .|..:|||.||.::
  Rat   490 VPMARLVLKSKNGIHLRLKK 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 126/410 (31%)
Cyp4a3XP_038965516.1 CYP4B-like 69..506 CDD:410771 124/405 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348497
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.