DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP4A22

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:436 Identity:129/436 - (29%)
Similarity:222/436 - (50%) Gaps:39/436 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YIWN-----FLFAPEYN--IVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRR 143
            :||.     .|:.|:|.  |:...|.:          .:.||:.:.|.:|.|||:...|.|...|
Human    89 WIWGGKVRVQLYDPDYMKVILGRSDPK----------SHGSYKFLAPRIGYGLLLLNGQTWFQHR 143

  Fly   144 KTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFE--LELNQIIPQFTLNNICETAL----GV 202
            :.||||||.:||:.::.:..:..:..:...::.:|.:  ||:.|.:...||:.|.::|.    .:
Human   144 RMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKSAFSHQGSI 208

  Fly   203 KLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHGFSSGIIQRKR 267
            ::|..|:  .|.:||.|...:....|.|.....:..:.|....:...|..:..|..:..:||.::
Human   209 QVDRNSQ--SYIQAISDLNSLVFCCMRNAFHENDTIYSLTSAGRWTHRACQLAHQHTDQVIQLRK 271

  Fly   268 QQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAE-GKI-DHQGICDEVNTFMFGGYDTTSTSLIFTL 330
            .|.:::  |::::..:|:....||.||.|:.| |.| ..:.:..||:||||.|:|||::.:.:.|
Human   272 AQLQKE--GELEKIKRKRHLDFLDILLLAKMENGSILSDKDLRAEVDTFMFEGHDTTASGISWIL 334

  Fly   331 LLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGR-TCIEESV 394
            ..||.|...||||.||:..|..|...::....:::.:....|||:|||:|..|.||| .....:.
Human   335 YALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYTTMCIKEALRLYPPVPGIGRELSTPVTF 399

  Fly   395 MNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKF 459
            .:|..|||...:.:.||.:..:.:.:|....|.|.||.|.::  :|..||:|||.|.|||||::|
Human   400 PDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRFAPGSA--QHSHAFLPFSGGSRNCIGKQF 462

  Fly   460 GVLEIKVLLAAVIRNFKLLP-ATQLE------DLTFENGIVLRTQQ 498
            .:.::||..|..:..|:||| .|::.      .|..:|||.||.::
Human   463 AMNQLKVARALTLLRFELLPDPTRIPIPMARLVLKSKNGIHLRLRR 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 129/436 (30%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 127/431 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154851
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.