DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP4X1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:388 Identity:118/388 - (30%)
Similarity:199/388 - (51%) Gaps:19/388 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFE---LELNQI 186
            |.||.||......||...|:.|||.||||||::::.:.....|..:...:|....:   :|:.:.
Human   119 PLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEH 183

  Fly   187 IPQFTLNNI--CETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYS 249
            |...:|:.|  |..:........|..:.|.|||.:...:...|:.:.|...:..|.|.....::.
Human   184 INSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQ 248

  Fly   250 RILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYA-MLDTLLAAEAE-----GKIDHQGIC 308
            ::.|.::.::..|||.::   |..|.|...:...|::|. .||.:|:|:.|     ..||   :.
Human   249 KLSRVLNQYTDTIIQERK---KSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDID---VH 307

  Fly   309 DEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIK 373
            .||:||:..|:||.:.|:.:.|..|||:.:.||||.||::.:..|...::..|..|:.:....||
Human   308 SEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIK 372

  Fly   374 ESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSV 437
            |:.||.|:.|.|.|...:. :..:|..||....:.:.|:.:..:...:..|..|.|.||..|||.
Human   373 ETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSD 437

  Fly   438 NRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENGIVLRTQQNI 500
            .|||:|::|||||.||||||:|.::|:||.:|.::.:|::.| .....|||.|..:|:.:..:
Human   438 QRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTP-DPTRPLTFPNHFILKPKNGM 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 118/388 (30%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 118/388 (30%)
heme binding region 447..460 10/12 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154831
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.