DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_663708.1 Gene:Cyp4x1 / 246767 RGDID:628719 Length:507 Species:Rattus norvegicus


Alignment Length:426 Identity:127/426 - (29%)
Similarity:211/426 - (49%) Gaps:35/426 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 FLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNI 154
            :::.|:|        .:||.|.........::|:.||||.|||.....:|...|..||||||.:|
  Rat    92 YIYDPDY--------AKIFLSRTDPKTQYLHQLMTPFLGRGLLNLDGPRWFQHRCLLTPAFHQDI 148

  Fly   155 LQSFLSIFKEESKKFIKILDKNVGFE---LELNQIIPQFTLNNICETALGVKLDDMSEG--NEYR 214
            |:..:.:........:...:|....:   :|:.:.|...||:.|.:.|.|.:.:....|  ..|.
  Rat   149 LKPCVDMMAHSVNMMLDKWEKTWTTQETTIEVFEHINLMTLDIIMKCAFGQETNCQINGTYESYV 213

  Fly   215 KAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKK---YSRILRTIHGFSSGIIQRKRQQFKQKQLG 276
            ||..:...:.:.|:.|   |::.:..:|....|   :..:.:.||..:..|||.:::..|.    
  Rat   214 KATFELGEIISSRLYN---FWHHHDIIFKLSPKGHCFQELGKVIHQCTEKIIQDRKKTLKD---- 271

  Fly   277 QVDEFGKKQRYAMLDTLLAAEA--EGKIDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADV 339
            ||::...:.....||.:|:|:|  |.......:..||||||:.|:|.::.|:.:.|..|||:.:.
  Rat   272 QVNQDDTQTSQNFLDIVLSAQAGDEKAFSDADLRSEVNTFMWAGHDASAASISWLLYCLALNPEH 336

  Fly   340 QERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKN 403
            |:||..|::.:..|...::..|.:|:.:....|||:|||.|..|.|.|...:. ::.:|..||..
  Rat   337 QDRCRTEIRSILGDGSSITWEQLDEIPYTTMCIKETLRLIPPIPSISRELSKPLTLPDGHSLPAG 401

  Fly   404 AQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLL 468
            ..:.:.|:.:..:...:..|..|.|.||..|||..|||.||:|||:||||||||:|.:||:||.:
  Rat   402 MTVVLSIWGLHHNPAVWKDPKVFDPLRFTKENSEQRHPCAFLPFSSGPRNCIGQQFAMLELKVAI 466

  Fly   469 AAVIRNFKLLPATQLEDLT----FENGIVLRTQQNI 500
            |..:..|::     ..|||    |.:..|||.:..|
  Rat   467 ALTLLRFRV-----AADLTRPPAFSSHTVLRPKHGI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 127/426 (30%)
Cyp4x1NP_663708.1 CYP4B-like 66..500 CDD:410771 127/426 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348683
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.