DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_058695.2 Gene:Cyp4b1 / 24307 RGDID:2480 Length:511 Species:Rattus norvegicus


Alignment Length:522 Identity:149/522 - (28%)
Similarity:255/522 - (48%) Gaps:50/522 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWIALLGSSLLIGALW-----LLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTRFGNNL 60
            |.:..|..||....||     |::..|.....:|...|..|..|..|      ..|....||:.|
  Rat     1 MVLNFLSPSLSRLGLWASVVILMVIVLKLFSLLLRRQKLARAMDSFP------GPPTHWLFGHAL 59

  Fly    61 DLLNLTPAN-IFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNMSYELIR 124
            ::..|...: :.|:.::..    ..:.:|...|....||...:.|:.::........:: |:...
  Rat    60 EIQKLGSLDKVVSWAQQFP----HAHPLWFGQFVGFLNIYEPDYAKAVYSRGDPKAADV-YDFFL 119

  Fly   125 PFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNVGFELELNQ 185
            .::|.|||:....||...||.|||.||:::|:.:::||.|.::    |:.|...:|..|::..: 
  Rat   120 QWIGKGLLVLDGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRMMLDKWEKKASENKSFDIFCD- 183

  Fly   186 IIPQFTLNNICETALGVKLDDMSEG---NEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKK 247
             :....|:.:.:...|  ..|...|   |.|..|:.|..::..||:.:.....::.::|....::
  Rat   184 -VGHMALDTLMKCTFG--KGDSGLGHRDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTPHGRR 245

  Fly   248 YSRILRTIHGFSSGII-QRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG--KIDHQGICD 309
            :.|..:..|..:..:| |||.....:|:..::.:   ::....||.||....|.  |:....:..
  Rat   246 FLRACKIAHDHTDEVIRQRKAALQDEKERKKIQQ---RRHLDFLDILLGVRDESGIKLSDAELRA 307

  Fly   310 EVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNEL---IHLECV 371
            ||:||||.|:|||::.:.:.|..:||:.:.|:.|.||::.:..|.|.   ||:::|   .:|...
  Rat   308 EVDTFMFEGHDTTTSGISWFLYCMALYPEHQQLCREEVRGILGDQDS---FQWDDLAKMTYLTMC 369

  Fly   372 IKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPEN 435
            :||..||:|..|.:.|...:. :.::|..||..:.||:|||.:.|::..:|.|..|.|.||.|||
  Rat   370 MKECFRLYPPVPQVYRQLNKPVTFVDGRSLPAGSLISLHIYALHRNSTVWPDPEVFDPLRFSPEN 434

  Fly   436 SVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKL--------LPATQLEDLTFENGI 492
            :..||||||:||||||||||||:|.:.|:||:.|..:..|:.        :...|| .|..:|||
  Rat   435 AAGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSLDPSKMPIKVPQL-ILRSKNGI 498

  Fly   493 VL 494
            .|
  Rat   499 HL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 136/467 (29%)
Cyp4b1NP_058695.2 p450 47..500 CDD:278495 136/474 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348755
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.