DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4a2

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_038965182.1 Gene:Cyp4a2 / 24306 RGDID:2479 Length:517 Species:Rattus norvegicus


Alignment Length:473 Identity:136/473 - (28%)
Similarity:230/473 - (48%) Gaps:78/473 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PANIFSYIRESTAKANGQNYIWNFLFAPEY-NIVRAEDAEEIFQSTKITTKNMSYELIRPFLGDG 130
            |.....::..|||:.        .|:.|:| .:|......:.:||            :.|::|.|
  Rat    80 PGACLQWLSGSTARV--------LLYDPDYVKVVLGRSDPKPYQS------------LAPWIGYG 124

  Fly   131 LLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNVGFELELNQIIPQFT 191
            ||:...:||...|:.||||||::||:.::.|..:...    |:.|:.|::  ..||:...:...|
  Rat   125 LLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVSIMLDKWEKLDDQD--HPLEIFHYVSLMT 187

  Fly   192 LNNICETAL----GVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYS--- 249
            |:.:.:.|.    .|:||..|  ..|.||:.|.         |.|:||......:|:...|:   
  Rat   188 LDTVMKCAFSHQGSVQLDVNS--RSYTKAVEDL---------NNLIFFRVRSAFYGNSIIYNMSS 241

  Fly   250 ------RILRTIH-------------GFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLA 295
                  |..:..|             ..|.|:|:.::.|.:.::  ::.:..||:....||.||.
  Rat   242 DGRLSRRACQIAHEHTGSVFLLPAFLSLSDGVIKTRKAQLQNEE--ELQKARKKRHLDFLDILLF 304

  Fly   296 AEAE-GK-IDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVS 358
            |:.| || :..:.:..||:||||.|:|||::.:.:....||.|.:.||||.||:|.:..|...|:
  Rat   305 AKMEDGKSLSDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGDGTSVT 369

  Fly   359 MFQFNELIHLECVIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPK 422
            ....:::.:....|||:|||:...|.:.|..... :..:|..:||..:::|.||.:..:..::|.
  Rat   370 WDHLDQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDGRSIPKGIRVTILIYGLHHNPSYWPN 434

  Fly   423 PNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP-ATQLE-- 484
            |..|.|.||.|::.  ||..|::|||.|.|||||::|.:.|:||.:|..:..|:||| .|::.  
  Rat   435 PKVFDPSRFSPDSP--RHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPVP 497

  Fly   485 ----DLTFENGIVLRTQQ 498
                .|..:|||.||.::
  Rat   498 MPRLVLKSKNGIHLRLKK 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 136/473 (29%)
Cyp4a2XP_038965182.1 CYP4B-like 69..512 CDD:410771 134/468 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.