DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4a29

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001093653.1 Gene:Cyp4a29 / 230639 MGIID:3717143 Length:509 Species:Mus musculus


Alignment Length:440 Identity:123/440 - (27%)
Similarity:213/440 - (48%) Gaps:46/440 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NYIW-NFLFA----PEYNIV---RAEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHT 141
            ::|| :.:|.    |:|..|   ||:            .|...|..:.|:||.||......:|..
Mouse    88 HWIWGSHVFIKVCDPDYMKVILGRAD------------PKASLYRFLTPWLGHGLFFLNGDEWFQ 140

  Fly   142 RRKTLTPAFHFNILQSFLSIFKEE----SKKFIKILDKNVGFELELNQIIPQFTLNNICETAL-- 200
            .|:.||||||::||:.::.|..:.    .:|:.:|..:::  .||:...|....|:.|.:.|.  
Mouse   141 HRRLLTPAFHYDILKPYVGIMADSVQVMLEKWEQIACQDI--TLEIFHPISLMMLDTIMKYAFSY 203

  Fly   201 --GVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHGFSSGII 263
              .|:||..|:.  |.:|:.|...:...||.|..:..:..:.|....::.:...:..|..:..::
Mouse   204 QGSVQLDRSSQA--YLQAVSDLNNLVTSRMKNVFLHNDIIYNLTSHSRRTNSACQIAHEHTDRVV 266

  Fly   264 QRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAE--GKIDHQGICDEVNTFMFGGYDTTSTSL 326
            :.::.|.:..:  .:.:...|:....||.||.:..:  ..:..:.:..||::.||||:||.::.:
Mouse   267 KLRKAQLQDNK--SMKKLRGKRCLDFLDILLLSRMDDGSSLSDKALRAEVDSLMFGGHDTPASGI 329

  Fly   327 IFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGR-TCI 390
            .:....||.|.|.|:||.||:|.|..|...::....:::.:....|||:|||:|..|.:|| ...
Mouse   330 SWVFYALATHPDHQQRCREEVQSLLGDGSPITWDHLHQMPYTTMCIKEALRLYPPIPSVGRKLST 394

  Fly   391 EESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCI 455
            ..:..:|..|||...:.:|.|.:..:.:.:|.|..|.|.|| ..||| :|..||:|||.|.||||
Mouse   395 PVTFPDGRSLPKGITVLLHFYALHHNPKVWPNPEVFDPSRF-AMNSV-QHSHAFLPFSGGSRNCI 457

  Fly   456 GQKFGVLEIKVLLAAVIRNFKLLP-------ATQLEDLTFENGIVLRTQQ 498
            |:...:..:||.:|..:..|:|||       .||...|..:|||.|..::
Mouse   458 GKHLAMNVLKVAVALTLLRFELLPDPSRVPIPTQQLVLKSKNGIYLHLRK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 123/440 (28%)
Cyp4a29NP_001093653.1 p450 52..503 CDD:278495 122/434 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845080
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.