DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP3A4

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_059488.2 Gene:CYP3A4 / 1576 HGNCID:2637 Length:503 Species:Homo sapiens


Alignment Length:495 Identity:127/495 - (25%)
Similarity:222/495 - (44%) Gaps:73/495 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VPGKTRFGNNLDLLNLTPANIFSYIR------ESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIF 108
            :||.|    .|..|    .||.||.:      ....|..|:  :|.| :..:..::...|.:.| 
Human    38 IPGPT----PLPFL----GNILSYHKGFCMFDMECHKKYGK--VWGF-YDGQQPVLAITDPDMI- 90

  Fly   109 QSTKITTKNMSYELI---RP-----FLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEE 165
               |.......|.:.   ||     |:...:.|:.|::|...|..|:|.|....|:..:.|..:.
Human    91 ---KTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQY 152

  Fly   166 SKKFIKIL--DKNVGFELELNQIIPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRM 228
            ....::.|  :...|..:.|..:...::::.|..|:.||.:|.::...:        ..|.|.:.
Human   153 GDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQD--------PFVENTKK 209

  Fly   229 CNPLMFFNWYFFLFGDYKKYSRIL---------RTIHGFSSGIIQR-KRQQFKQKQLGQVDEFGK 283
            .....|.:.:|.....:.....||         |.:..|....::| |..:.:..|..:||..  
Human   210 LLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFL-- 272

  Fly   284 KQRYAMLDTLLAAEAEGKIDHQGICD-----EVNTFMFGGYDTTSTSLIFTLLLLALHADVQERC 343
               ..|:|:..:.|.|   .|:.:.|     :...|:|.||:|||:.|.|.:..||.|.|||::.
Human   273 ---QLMIDSQNSKETE---SHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKL 331

  Fly   344 YEELQDL-----PEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKN 403
            .||:..:     |...|.|...::     |:.|:.|:|||||.|..:.|.|.::..:||:.:||.
Human   332 QEEIDAVLPNKAPPTYDTVLQMEY-----LDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKG 391

  Fly   404 AQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLL 468
            ..:.|..|.:.||.:::.:|.:||||||..:|..|..|:.:.||.:|||||||.:|.::.:|:.|
Human   392 VVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLAL 456

  Fly   469 AAVIRNFKLLPATQLE-DLTFENGIVLRTQQNIKVKFEAR 507
            ..|::||...|..:.: .|....|.:|:.::.:.:|.|:|
Human   457 IRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 124/489 (25%)
CYP3A4NP_059488.2 p450 39..493 CDD:365848 124/489 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.