DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP3A7

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_000756.3 Gene:CYP3A7 / 1551 HGNCID:2640 Length:503 Species:Homo sapiens


Alignment Length:407 Identity:110/407 - (27%)
Similarity:195/407 - (47%) Gaps:48/407 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 FLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKIL--DKNVGFELELNQIIP 188
            |:.:.:.|:.|::|...|..|:|.|....|:..:.|..:.....::.|  :...|..:.|..:..
Human   113 FMKNAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKHVFG 177

  Fly   189 QFTLNNICETALGVKLDDMSEGN----EYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYS 249
            .::::.|..|:.||.:|.::...    |..|.:..|         |||..|      ....|.:.
Human   178 AYSMDVITSTSFGVSIDSLNNPQDPFVENTKKLLRF---------NPLDPF------VLSIKVFP 227

  Fly   250 RILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQR--------YAMLDTLLAAEAEGKIDHQG 306
            .:...:...:..:..||...|..|.:.|:.|...|:.        ..|:|:..:.::|   .|:.
Human   228 FLTPILEALNITVFPRKVISFLTKSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSE---THKA 289

  Fly   307 ICD-----EVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDL-----PEDIDEVSMFQ 361
            :.|     :...|:|.||:|||:.|.|.:..||.|.|||::..:|:..:     |...|.|.   
Human   290 LSDLELMAQSIIFIFAGYETTSSVLSFIIYELATHPDVQQKVQKEIDTVLPNKAPPTYDTVL--- 351

  Fly   362 FNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQF 426
              :|.:|:.|:.|:|||||.|..:.|.|.::..:||:.:||...:.|..|.:..|.:::.:|.:|
Human   352 --QLEYLDMVVNETLRLFPVAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWTEPEKF 414

  Fly   427 LPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLE-DLTFEN 490
            |||||..:|..|..|:.:.||.:|||||||.:|.::.:|:.|..|::||...|..:.: .|....
Human   415 LPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALVNMKLALVRVLQNFSFKPCKETQIPLKLRF 479

  Fly   491 GIVLRTQQNIKVKFEAR 507
            |.:|.|::.|.:|.|:|
Human   480 GGLLLTEKPIVLKAESR 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 107/402 (27%)
CYP3A7NP_000756.3 p450 39..492 CDD:365848 107/401 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.