DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:175 Identity:60/175 - (34%)
Similarity:102/175 - (58%) Gaps:11/175 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 AEDAEEIFQSTKITTKNMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEE 165
            |:..|.||.|||...|..:|.|:.|:||..:|.|..::|..:||.|||.||::||:.||.||.|:
 Worm    87 ADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQKEQWRPKRKLLTPTFHYDILKDFLPIFNEQ 151

  Fly   166 SKKFIK------ILDKNVGFELELNQIIPQFTLNNICETALGVKLD-DMSEGNEYRKAIHDFEIV 223
            ||..|:      :.|:    |:::..:|...||:.||||::|..:. .::|.|||..|:|....:
 Worm   152 SKILIQKLCCLGVADE----EVDVLSVITLCTLDIICETSMGKAIGAQLAENNEYVWAVHTINKL 212

  Fly   224 FNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHGFSSGIIQRKRQ 268
            .::|..||||:.::.:.|..|.:.:.:.|..:|.|:..:|..:::
 Worm   213 ISKRTNNPLMWNSFIYNLTEDGRTHEKCLHILHDFTKKVIVERKE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 60/175 (34%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 60/175 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163557
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.