DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4b1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_031849.1 Gene:Cyp4b1 / 13120 MGIID:103225 Length:511 Species:Mus musculus


Alignment Length:523 Identity:153/523 - (29%)
Similarity:251/523 - (47%) Gaps:52/523 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWIALLGSSLLIGALWLLLRQLNKTYF-ILSLC----KRVRTADGSPLESKVFVVPGKTRFGNNL 60
            |.::.|..||....||..:..|..|.. :|||.    |..|..|..|...|.::      ||:.|
Mouse     1 MALSFLSPSLSRLGLWASVVILMVTVLKLLSLLFRRQKLARALDSFPGPPKHWL------FGHAL 59

  Fly    61 DLLN-------LTPANIFSYIRESTAKANGQNYIWNFLFAPEYNIVRAEDAEEIFQSTKITTKNM 118
            ::..       :|....|.|...          :|...|....||...:.|:.:: |........
Mouse    60 EIQKTGGLDKVVTWTEQFPYAHP----------LWLGQFIVFLNIYEPDYAKAVY-SRGDPKAAY 113

  Fly   119 SYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNVGF 179
            .|:....::|.|||:....||...||.|||.||:::|:.:::||.|.::    |:.|...:|..|
Mouse   114 VYDFFLQWIGKGLLVLEGPKWFQHRKLLTPGFHYDVLKPYVAIFAESTRVMLDKWEKKASENKSF 178

  Fly   180 ELELNQIIPQFTLNNICETALGVKLDDMSEG-NEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFG 243
            ::..:  :....|:.:.:...|.....:|.. |.|..|:.|..::..||:.:.....::.::|..
Mouse   179 DIFCD--VGHMALDTLMKCTFGKGDSGLSHSDNSYYLAVSDLTLLMQQRIDSFQYHNDFIYWLTP 241

  Fly   244 DYKKYSRILRTIHGFSSGII-QRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG--KIDHQ 305
            ..:::.|..:..|..:..:| |||.....:|:..::.|   ::....||.||.|..|.  |:...
Mouse   242 HGRRFLRACQIAHDHTDHVIRQRKAALQDEKEQKKLQE---RRHLDFLDILLGARDESGIKLSDA 303

  Fly   306 GICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLEC 370
            .:..||:||||.|:|||::.:.:.|..:||:...|:||.||::::..|.|........::.:|..
Mouse   304 DLRAEVDTFMFEGHDTTTSGISWFLYCMALYPMHQQRCREEVREILGDRDSFQWDDLAQMTYLTM 368

  Fly   371 VIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPE 434
            .:||..||:|..|.:.|...:. :.::|..||..:.||:|||.:.|::..:|.|..|.|.||.||
Mouse   369 CMKECFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVWPDPEVFDPLRFSPE 433

  Fly   435 NSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP--------ATQLEDLTFENG 491
            |...||||||:||||||||||||:|.:.|:||:.|..:..|:..|        ..|| .|..:||
Mouse   434 NMTGRHPFAFMPFSAGPRNCIGQQFAMNEMKVVTALCLLRFEFSPDPSKIPIKVPQL-ILRSKNG 497

  Fly   492 IVL 494
            |.|
Mouse   498 IHL 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 137/468 (29%)
Cyp4b1NP_031849.1 p450 47..500 CDD:278495 138/475 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.