DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4a12b

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_758510.2 Gene:Cyp4a12b / 13118 MGIID:3611747 Length:508 Species:Mus musculus


Alignment Length:399 Identity:122/399 - (30%)
Similarity:204/399 - (51%) Gaps:32/399 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFE--L 181
            ||..:.|::|.|||:...|.|...|:.||||||::||:.:..|..:.....:...::.||.:  |
Mouse   117 SYRFLAPWIGRGLLLLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVHVMLDKWEQIVGQDSTL 181

  Fly   182 ELNQIIPQFTLNNICETAL----GVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLF 242
            |:.|.|...||:.|.:.|.    .|:||  .:...|.:|:.|...:|..|:.|        .|..
Mouse   182 EIFQHITLMTLDTIMKCAFSHEGSVQLD--RKYKSYIQAVEDLNNLFFLRVRN--------IFHQ 236

  Fly   243 GD--YKKYSR------ILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAE 299
            .|  |:..|.      ..:..|..:..:|:.:|.|.:.::  ::::..||:|...||.||.|..|
Mouse   237 NDIIYRVSSNGCLANSACQLAHDHTDQVIKSRRSQLQDEE--ELEKLKKKRRLDFLDILLFARME 299

  Fly   300 -GK-IDHQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQF 362
             || :..:.:..||:||||.|:|||::.:.:....||.:.:.|:||.:|:|.|..|...::....
Mouse   300 NGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGASITWNDL 364

  Fly   363 NELIHLECVIKESLRLFPSAPIIGRTCIEE-SVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQF 426
            :::.:....|||:||::|..|.:.|..... :..:|..|||...:.:..|.:..:...:|.|..|
Mouse   365 DKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVF 429

  Fly   427 LPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENG 491
            .|.||.|.:|  ||..:|:|||.|.|||||::|.:.|:||.:|..:..|:|||......:.... 
Mouse   430 DPSRFAPGSS--RHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPR- 491

  Fly   492 IVLRTQQNI 500
            |||:::..|
Mouse   492 IVLKSKNGI 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 122/399 (31%)
Cyp4a12bNP_758510.2 CYP4B-like 70..503 CDD:410771 122/399 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845068
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.