DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4a10

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_034141.3 Gene:Cyp4a10 / 13117 MGIID:88611 Length:509 Species:Mus musculus


Alignment Length:399 Identity:127/399 - (31%)
Similarity:218/399 - (54%) Gaps:24/399 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNV 177
            |.:|.|:.|::|.|||:...|.|...|:.||||||::||:.::....:..:    |:.::.|:: 
Mouse   116 NGAYRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLDKWERLADQD- 179

  Fly   178 GFELELNQIIPQFTLNNICETALGVKLDDMSEGN--EYRKAIHDFEIVFNQRMCNPLMFFNWYFF 240
             ..:|:.|.|...||:.:.:.|...|.....:||  .|.:||.|...:|:.|:.|.....:..:.
Mouse   180 -SSIEIFQHISLMTLDTVMKCAFSHKGSVQVDGNYRTYLQAIGDLNNLFHSRVRNIFHQNDTIYK 243

  Fly   241 LFGDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG--KID 303
            |..:.:...:..:..|..:.|:|:.::.|.:.:  |::::..||:|...||.||.|..|.  .:.
Mouse   244 LSSNGRLAKQACQLAHDHTDGVIKLRKDQLQDE--GELEKIKKKRRLDFLDILLFARMENGDSMS 306

  Fly   304 HQGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHL 368
            .:.:..||:||||.|:|||::.:.:....||.|.|.|:||.||:|.|..|...::....:::.:.
Mouse   307 DKDLRAEVDTFMFEGHDTTASGVSWIFYALATHPDHQQRCREEVQSLLGDGSSITWDHLDQIPYT 371

  Fly   369 ECVIKESLRLFPSAPIIGRTCIEESVM--NGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERF 431
            ...|||:|||:|..|.|.|. :..||.  :|..|||..|:::.||.:..:.:.:|.|..|.|.||
Mouse   372 TMCIKEALRLYPPVPGIVRE-LSTSVTFPDGRSLPKGVQVTLSIYGLHHNPKVWPNPEVFDPSRF 435

  Fly   432 LPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP-ATQLE------DLTFE 489
            .|::.  ||..:|:|||.|.|||||::|.:.|:||::|..:..|:||| .|::.      .|..:
Mouse   436 APDSP--RHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLRFELLPDPTRVPMPLARLVLKSK 498

  Fly   490 NGIVLRTQQ 498
            |||.|..::
Mouse   499 NGIYLHLKK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 127/399 (32%)
Cyp4a10NP_034141.3 p450 52..503 CDD:278495 126/393 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845282
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.