DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp19a1

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001335100.1 Gene:Cyp19a1 / 13075 MGIID:88587 Length:503 Species:Mus musculus


Alignment Length:382 Identity:91/382 - (23%)
Similarity:176/382 - (46%) Gaps:40/382 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 WHTRR----KTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFELELNQIIPQFTLNNICETA 199
            |.|.|    |.||......:::..:...|:...:..::.|.: |: :::..::....|:......
Mouse   141 WRTIRPFFMKALTGPGLVRMVEVCVESIKQHLDRLGEVTDTS-GY-VDVLTLMRHIMLDTSNMLF 203

  Fly   200 LGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFF--NWYFFLFGDYKKYSRILRTIHGFSSGI 262
            ||:.||:    :...|.|..:...:...:..|.:||  :|.      |:||.|.::.:....:.:
Mouse   204 LGIPLDE----SAIVKKIQGYFNAWQALLIKPNIFFKISWL------YRKYERSVKDLKDEIAVL 258

  Fly   263 IQRKRQQFK-QKQLGQVDEFGKKQRYAMLDTLLAAEAEGKIDHQGICDEVNTFMFGGYDTTSTSL 326
            :::||.:.. .::|....:|.        ..|:.||..|.:..:.:...:...:....||.|.:|
Mouse   259 VEKKRHKVSTAEKLEDCMDFA--------TDLIFAERRGDLTKENVNQCILEMLIAAPDTMSVTL 315

  Fly   327 IFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIE 391
            .|.|||:|.:.:|:....:|:..:..|.| :.:.....|..:|..|.||:|..|...::.|..:|
Mouse   316 YFMLLLVAEYPEVEAAILKEIHTVVGDRD-IKIEDIQNLKVVENFINESMRYQPVVDLVMRRALE 379

  Fly   392 ESVMNGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFA-FVPFSAGPRNCI 455
            :.|::|..:.|...|.::| ..|....:|||||:|..|.|  |.:|   |:. |.||..|||.|.
Mouse   380 DDVIDGYPVKKGTNIILNI-GRMHRLEYFPKPNEFTLENF--EKNV---PYRYFQPFGFGPRGCA 438

  Fly   456 GQKFGVLEIKVLLAAVIRNF--KLLPATQLEDLTFENGIVLRTQQN---IKVKFEAR 507
            |:...::.:||:|..::|.|  |.|....:|::..:|.:.|...::   :::.|..|
Mouse   439 GKYIAMVMMKVVLVTLLRRFQVKTLQKRCIENIPKKNDLSLHPNEDRHLVEIIFSPR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 89/377 (24%)
Cyp19a1NP_001335100.1 p450 48..488 CDD:306555 89/373 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845356
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.