DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and CYP4F8

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_009184.1 Gene:CYP4F8 / 11283 HGNCID:2648 Length:520 Species:Homo sapiens


Alignment Length:521 Identity:169/521 - (32%)
Similarity:268/521 - (51%) Gaps:39/521 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 WIALLGSSLLIGALWLLLRQLNKTYFILSLCKRVRTADGSPLESKVFVVPGKTR-FGNNLDLLNL 65
            |:.|    |::||.|||.|.|..||......:|:|          .|..|.|.. |..:|.|  :
Human    19 WLLL----LVVGASWLLARILAWTYAFYHNGRRLR----------CFPQPRKQNWFLGHLGL--V 67

  Fly    66 TPANIFSYIRESTAKANGQNYI-WNFLFAPEYNIVRAEDAEEIFQ-STKITTKN-MSYELIRPFL 127
            ||......:.........|.:: |.....|..|:...:....:.. |..||.|: :.|:.::|:|
Human    68 TPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWL 132

  Fly   128 GDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFE----LELNQIIP 188
            |||||:|:..||...|:.||||||||||:.::.|| .:|...:....:.:..|    |::.:.|.
Human   133 GDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIF-SKSANIMHAKWQRLAMEGSTCLDVFEHIS 196

  Fly   189 QFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILR 253
            ..||:::.:.......:...:.:||..||.:...:..:|......:.::.:||....:::.|..|
Human   197 LMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRRFHRACR 261

  Fly   254 TIHGFSSGIIQRKRQQFKQKQLGQVDEF----GKKQRYAMLDTLLAAE-AEGK-IDHQGICDEVN 312
            .:|.|:..:||.:|:....:   .||:|    .|.:....:|.||.:| ..|| :..:.|..|.:
Human   262 LVHDFTDAVIQERRRTLTSQ---GVDDFLQAKAKSKTLDFIDVLLLSEDKNGKELSDEDIRAEAD 323

  Fly   313 TFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDID--EVSMFQFNELIHLECVIKES 375
            ||||||:|||::.|.:.|..||.|.:.||||.:|:|:|.:|.:  |:......:|..|...:|||
Human   324 TFMFGGHDTTASGLSWVLYNLARHPEYQERCRQEVQELLKDREPKEIEWDDLAQLPFLTMCLKES 388

  Fly   376 LRLFPSAPIIGRTCIEESVM-NGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNR 439
            |||.|..|...|.|.::.|: :..|:||....:|:|:.|..:...:|.|..:.|.||.|||:..|
Human   389 LRLHPPIPTFARGCTQDVVLPDSRVIPKGNVCNINIFAIHHNPSVWPDPEVYDPFRFDPENAQKR 453

  Fly   440 HPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENGIVLRTQQNIKVKF 504
            .|.||:||||||||||||||.:.|:||:||..:..|::||..:....|.|  ||||.:..:.::.
Human   454 SPMAFIPFSAGPRNCIGQKFAMAEMKVVLALTLLRFRILPDHREPRRTPE--IVLRAEDGLWLRV 516

  Fly   505 E 505
            |
Human   517 E 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 153/469 (33%)
CYP4F8NP_009184.1 p450 52..504 CDD:306555 149/459 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154843
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.