DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and LOC103692784

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:XP_038935978.1 Gene:LOC103692784 / 103692784 RGDID:9252969 Length:337 Species:Rattus norvegicus


Alignment Length:337 Identity:106/337 - (31%)
Similarity:177/337 - (52%) Gaps:28/337 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 IPQFTLNNICETALGVKLDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRI 251
            |...||:::.:...|...:.....:||..||.:...:..:|.....::.::.::...|.:::.:.
  Rat     5 ISLMTLDSLQKCLFGFDSNCQESPSEYISAILELSSLTIKRSYQLFLYLDFLYYRTADGRRFRKA 69

  Fly   252 LRTIHGFSSGIIQRKRQQFKQKQLGQVDEF------GKKQRYAMLDTLLAAEAE-GK-IDHQGIC 308
            ...:|.|:..:|:.:|:....:   .||||      .|.:....:|.||.|:.| || :..:.|.
  Rat    70 CDLVHSFTDAVIRERRRLLSSQ---GVDEFLESKTKSKSKTLDFIDVLLLAKDEHGKELSDEDIR 131

  Fly   309 DEVNTFMFG--GYDTTSTSLIFTLLLLALHADVQERCYEELQDL-----PEDI--DEVSMFQFNE 364
            .|.:|||||  .:|||:::|.:.|..||.|.:.||.|.:|:.:|     ||:|  |:::...|  
  Rat   132 AEADTFMFGDESHDTTASTLSWILYNLARHPEYQESCLQEVWELLRDREPEEIEWDDLAQLPF-- 194

  Fly   365 LIHLECVIKESLRLFPSAPIIGRTCIEESVM-NGLVLPKNAQISIHIYDIMRDARHFPKPNQFLP 428
               |...|||||||.|.|..:.|.|.::.|: :|.|:||.....|.|:.|..:...:|.|..:.|
  Rat   195 ---LTMCIKESLRLHPPAVDLLRRCTQDIVLPDGRVIPKGNICVISIFGIHHNPSVWPDPEVYDP 256

  Fly   429 ERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLPATQLEDLTFENGIV 493
            .||.||:...|.|.:|:||||||||||||.|.:.|:||.:|..:..|:|||..  ::...:..|:
  Rat   257 FRFDPESRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRFRLLPDD--KEPRRKPEII 319

  Fly   494 LRTQQNIKVKFE 505
            ||.:..:::..|
  Rat   320 LRAEGGLRLLVE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 105/334 (31%)
LOC103692784XP_038935978.1 cytochrome_P450 <1..328 CDD:425388 105/332 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.