DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp2c69

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001097995.1 Gene:Cyp2c69 / 100043108 MGIID:3721049 Length:491 Species:Mus musculus


Alignment Length:401 Identity:94/401 - (23%)
Similarity:167/401 - (41%) Gaps:73/401 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PFL-----GDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFK--------EESKKFIKILDKN 176
            ||.     |.|:..|....|...|     .|..|.|:: |::.|        ||::..:|.|.|.
Mouse   101 PFFDKVSKGKGIGFSHGNVWKATR-----VFTVNTLRN-LAMGKRTIENKVQEEAQWLMKELKKT 159

  Fly   177 VGFELELNQIIPQFTL-----NNICETALGVKLDDMSEGNEYRKAIHDF-EIVFNQRMCNPLM-- 233
            .|...:     |||.:     |.||......:.|       |:.  .|| .::.....|..::  
Mouse   160 NGSPCD-----PQFIIGCAPCNVICSIVFQNRFD-------YKD--KDFLSLIGKVNECTEILSS 210

  Fly   234 ----FFNWYFFLFGDY--KKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDT 292
                .||....|. ||  .::::..:......|.::::.::..:...:....:|        :|.
Mouse   211 PGCQIFNAVPILI-DYCPGRHNKFFKNHTWIKSYLLEKIKEHEESLDVTNPRDF--------IDY 266

  Fly   293 LLAAEAEGK-IDH-----QGICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDL- 350
            .|....:.| |:|     :.:...|...:|||.:|.|:::.|.||||..|..:..:..||:.:: 
Mouse   267 FLIQRRQDKGIEHMEYTIEHLATLVTDLVFGGTETLSSTMRFALLLLMKHTHITAKVQEEIDNVI 331

  Fly   351 -----PEDIDEVSMFQFNELIHLECVIKESLRLFPSAPIIGRTCIEESVMNGLVLPKNAQISIHI 410
                 |...|...|...|.::|   .::..:.|.|::.:...||  ::......:||..|:...:
Mouse   332 GRHRSPCMQDRKHMPYTNAMVH---EVQRYVDLGPTSLVHEVTC--DTKFRNYFIPKGTQVMTSL 391

  Fly   411 YDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNF 475
            ..::.|:..||.|..|.|..||.:|...:....|||||||.|.|:|:....:|:.:.|..:::||
Mouse   392 SSVLHDSTEFPNPEVFDPGHFLDDNGNFKKSDYFVPFSAGKRICVGESLARMELFLFLTTILQNF 456

  Fly   476 KLLPATQLEDL 486
            ||.|....:|:
Mouse   457 KLKPLVDPKDI 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 94/401 (23%)
Cyp2c69NP_001097995.1 p450 30..487 CDD:278495 94/401 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.