DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and Cyp4a32

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001093651.1 Gene:Cyp4a32 / 100040843 MGIID:3717148 Length:509 Species:Mus musculus


Alignment Length:397 Identity:125/397 - (31%)
Similarity:216/397 - (54%) Gaps:20/397 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 NMSYELIRPFLGDGLLISIDQKWHTRRKTLTPAFHFNILQSFLSIFKEESKKFIKILDKNVGFE- 180
            |..|.|:.|::|.|||:...|.|...|:.||||||::||:.::....:..:..:...::..|.: 
Mouse   116 NGIYRLLAPWIGYGLLLLNGQPWFQHRRMLTPAFHYDILKPYVKNMADSIRLMLDKWERLAGQDS 180

  Fly   181 -LELNQIIPQFTLNNICETALGVKLDDMSEGN--EYRKAIHDFEIVFNQRMCNPLMFFNWYFFLF 242
             :|:.|.|...||:.:.:.|...|.....:||  .|.:||.|...:|:.|:.|.....:..:.|.
Mouse   181 SIEIFQHISLMTLDTVMKCAFSHKGSVQVDGNYKTYLQAIGDLNNLFHSRVRNIFHQNDTIYRLS 245

  Fly   243 GDYKKYSRILRTIHGFSSGIIQRKRQQFKQKQLGQVDEFGKKQRYAMLDTLLAAEAEG--KIDHQ 305
            .:.:...:..:..|..:.|:|:.::.|.:.:  |:::...||:|...||.||.|..|.  .:..:
Mouse   246 SNGRLAKQACQLAHDHTDGVIKMRKDQLQDE--GELENIKKKRRLDFLDILLFARMENGDSMSDK 308

  Fly   306 GICDEVNTFMFGGYDTTSTSLIFTLLLLALHADVQERCYEELQDLPEDIDEVSMFQFNELIHLEC 370
            .:..||:||||.|:|||::.:.:....||.|.:.|:||.||:|.|..|...::....:::.:...
Mouse   309 DLRAEVDTFMFEGHDTTASGVSWIFYALATHPEHQQRCREEVQSLLGDGSSITWDHLDQIPYTTM 373

  Fly   371 VIKESLRLFPSAPIIGRTCIEESVM--NGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLP 433
            .|||:|||:|..|.|.|. :..||.  :|..|||..|:::.||.:..:.:.:|.|..|.|.||.|
Mouse   374 CIKEALRLYPPVPGIVRE-LSTSVTFPDGRSLPKGVQVTLSIYGLHHNPKVWPNPEVFDPSRFAP 437

  Fly   434 ENSVNRHPFAFVPFSAGPRNCIGQKFGVLEIKVLLAAVIRNFKLLP-ATQLED------LTFENG 491
            ::.  ||..:|:|||.|.|||||::|.:.|:||::|..:.:|:||| .|::.:      |..:||
Mouse   438 DSP--RHSHSFLPFSGGARNCIGKQFAMSELKVIVALTLLHFELLPDPTRVPEPLARIVLKSKNG 500

  Fly   492 IVLRTQQ 498
            |.|..::
Mouse   501 IYLHLKK 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 125/397 (31%)
Cyp4a32NP_001093651.1 p450 52..503 CDD:278495 124/391 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.