DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac3 and cyp4f3

DIOPT Version :9

Sequence 1:NP_608918.1 Gene:Cyp4ac3 / 33756 FlyBaseID:FBgn0031695 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_001083010.1 Gene:cyp4f3 / 100037390 ZFINID:ZDB-GENE-070410-108 Length:511 Species:Danio rerio


Alignment Length:445 Identity:139/445 - (31%)
Similarity:228/445 - (51%) Gaps:36/445 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GQNYIWNFLFAPEYNIVRAEDAEEI----FQSTKITTKN-MSYELIRPFLGDGLLISIDQKWHTR 142
            |.:..| || .|.||:||....:.|    ..|..||.|: :.|..::|:||:.||:...|:|...
Zfish    70 GHSCSW-FL-GPFYNMVRLFHPDYIRSLLTASASITLKDRIFYGFMKPWLGNCLLLQSGQEWSRH 132

  Fly   143 RKTLTPAFHFNILQSFLSIFKEESK----KFIKILDKNVGFELELNQIIPQFTLNNICETALGVK 203
            |:.|||||||:||:.::.||.:.:.    ::.::|.|. ...:::.:.|...||:::.:......
Zfish   133 RRLLTPAFHFDILKKYVHIFNQSTNIMHDEWRRLLAKG-EHSVDMFEQISSLTLDSLLKCTFSCD 196

  Fly   204 LDDMSEGNEYRKAIHDFEIVFNQRMCNPLMFFNWYFFLFGDYKKYSRILRTIHGFSSGIIQRKRQ 268
            .....:..:|..||.|...:..||.......::|.::.....:::.:....:|.|::.|:|.:|.
Zfish   197 THSQEKPRQYISAILDLSRLLVQRQHYLPYHWDWLYWRSAQGRRFQQACAVVHQFTADIVQERRT 261

  Fly   269 QFKQKQLGQ-----VDEFGKKQRYAMLDTLLAA---EAEGKIDHQGICDEVNTFMFGGYDTTSTS 325
            |..|:...:     ...:.|::...::|.||.|   :.|| :.::.|....:.|||.|:|||:::
Zfish   262 QLDQQSDPESHPENTGRYRKRKNTDLIDLLLLAKDDKGEG-LTNEEIKAHADMFMFAGHDTTASA 325

  Fly   326 LIFTLLLLALHADVQERCYEELQDLPEDID--EVSMFQFNELIHLECVIKESLRLFPSAPIIGRT 388
            |.:....||::.|.||||..|::||..|.|  .:.....::|......|||||||  .:|::..|
Zfish   326 LSWIFYNLAMNQDYQERCRAEVRDLLADRDTHTIGWEDLSQLTFTTMCIKESLRL--HSPVLALT 388

  Fly   389 CIEESVM---NGLVLPKNAQISIHIYDIMRDARHFPKPNQFLPERFLPENSVNRHPFAFVPFSAG 450
            ......|   ...|:|......|.||.:.|:.:.:|.|..|.|.||.|.||.:|.|.||:|||||
Zfish   389 RYYSQNMKTPGDCVIPHGCLCLISIYGVHRNPQVWPDPLVFDPTRFDPHNSDSRSPHAFIPFSAG 453

  Fly   451 PRNCIGQKFGVLEIKVLLAAVIRNFKLLPAT-------QLEDLTFENGIVLRTQQ 498
            |||||||.|.:.|:||::|..:..||:||..       ||. |..|.|::|..|:
Zfish   454 PRNCIGQNFAMAEMKVVVALTLARFKILPGPKPVRRLYQLV-LRAEGGMILHFQE 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac3NP_608918.1 p450 51..504 CDD:278495 139/445 (31%)
cyp4f3NP_001083010.1 p450 38..503 CDD:278495 137/439 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.