DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and CYP96A14P

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_176777.1 Gene:CYP96A14P / 842916 AraportID:AT1G66030 Length:167 Species:Arabidopsis thaliana


Alignment Length:122 Identity:26/122 - (21%)
Similarity:50/122 - (40%) Gaps:29/122 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 NFDLVNFTSESIFNF----------MR-----DASAKAKGRNYLWYFFHAPMYNIVRAEEAEEIL 109
            ::.|:..:...::|:          ||     |.|......:.|.:.|..|.:..:      :||
plant    29 SYILIKISQSGLWNWPVLGMSPGALMRLPRIYDFSVDLLENSNLTFHFKGPWFAGI------DIL 87

  Fly   110 QSSKLITKNMIY-------ELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSF 159
            .::..:..|.||       |:..|| |:|::.|..:.|.:.:||....|:.:..|.|
plant    88 ATADSVNINHIYYRGPELREIFGPF-GDGIINSDSELWRNLKKATQVIFNHQKYQKF 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 26/122 (21%)
CYP96A14PNP_176777.1 p450 1..>166 CDD:386267 26/122 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.