DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and CYP702A1

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_176744.1 Gene:CYP702A1 / 842878 AraportID:AT1G65670 Length:482 Species:Arabidopsis thaliana


Alignment Length:463 Identity:93/463 - (20%)
Similarity:173/463 - (37%) Gaps:122/463 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YELLKP------------------------FLGEGLLISTDQKWHSR--RKALTPAFHFKVLQSF 159
            :|.:||                        ..|..::||||.:.:..  :....|.....:.|.|
plant    49 FEFMKPHDAFQFPTFIKERIIRYGPIFRTSLFGAKVIISTDIELNMEIAKTNHAPGLTKSIAQLF 113

  Fly   160 ----LIIFKEECNKLVK----VLHQSVNMELELNQVIPQFTLNNVCETA----LGVK-------L 205
                |....:|.:|.|:    .|..|..::|.:.|.|...|..::.|.|    |.||       :
plant   114 GENNLFFQSKESHKHVRNLTFQLLGSQGLKLSVMQDIDLLTRTHMEEGARRGCLDVKEISSKILI 178

  Fly   206 DDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYFFLF-------GDYRKQVNNLKIAHEFSSNI 263
            :.|::.:.......|.:|:.....|.|..:     |.|       |.|:......::.|.....|
plant   179 ECLAKKVTGDMEPEAAKELALCWRCFPSGW-----FRFPLNLPGTGVYKMMKARKRMLHLLKETI 238

  Fly   264 IEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLI 328
            ::||.|   ..:||   ||.|    .:.:.......|..|::      :.|......:||...|.
plant   239 LKKRAS---GEELG---EFFK----IIFEGAETMSVDNAIEY------IYTLFLLANETTPRILA 287

  Fly   329 FTLLMLALHEDVQKKCYEE----IKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRR 389
            .|:.:::.:..|.|:.:.|    ::...:....|:..::..:.:.:.||.||||:..:.|.:.|.
plant   288 ATIKLISDNPKVMKELHREHEGIVRGKTEKETSITWEEYKSMTFTQMVINESLRITSTAPTVFRI 352

  Fly   390 CVEEGVVNGLIMP--------KNTQINIHLYEIMRDARHFSNPKMFQPDRFFPEN---TVNRHPF 443
            ...|..|....:|        .|...|...|:         :|.:|.|.|:..::   .|:|   
plant   353 FDHEFQVGSYKIPAGWIFMGYPNNHFNPKTYD---------DPLVFNPWRWEGKDLGAIVSR--- 405

  Fly   444 AFVPFSAGQRNCIGQKFAILEIKVLL-------------AAVIRNFKILPVTLLDDLTFENGIVL 495
            .::||.||.|.|:|.:||.|::.:.:             ..::|||.::         |.||..:
plant   406 TYIPFGAGSRQCVGAEFAKLQMAIFIHHLSRDRWSMKIGTTILRNFVLM---------FPNGCEV 461

  Fly   496 RTKQNIKV 503
            :..::.:|
plant   462 QFLKDTEV 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 93/463 (20%)
CYP702A1NP_176744.1 p450 8..440 CDD:386267 86/423 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.